News

US banks are pushing back against a cyberattack disclosure ruleThe banks say its adds complexity and strain to their systemsBanks especially don't want to disclose ongoing cyberattacksA group of US banks is pushing back against a recent US Securities and Exchange Commission (SEC) ruling which requires public companies, including banks, to disclose cyber attacks.The banks argue that the ruling adds unnecessary strain and complexity to their operation, and potentially requires the disclosure of cyber incidents before internal investigations have been completed, and the scope of the damage assessed.The group's members include the American Bankers Association (ABA), the Bank Policy Institute (BPI), the Securities Industry and Financial Markets Association (SIFMA), the Independent Community Bankers of America (ICBA) and the Institute of International Bankers (IIB).SEC and banks butt headsThe rule, known formally as the “Cybersecurity Risk Management, Strategy, Governance, and Incident Disclosure Rule", was introduced in July 2023.Not only does it outline disclosure procedures for cyber incidents, such as impact, timings and scope of the incident, but also requires public companies to provide a report on their cybersecurity risk management, strategy and governance practices each year.A public statement issued by the Bank Policy Institute said, "This rule requires public companies to disclose material cyber incidents within four business days, adding to an already complex list of reporting and disclosure obligations that financial institutions and other critical infrastructure sector companies must follow. The Department of Homeland Security issued a report in 2023 identifying 45 different federal cyber incident reporting requirements, administered by 22 federal agencies."The banks also argue that the rule could apply additional pressure on banks and their customers during ransomware attacks, as the attackers could point out unfulfilled disclosures as a means of extortion.The banking group lobbied against the rule in 2023, and requested a 12 month extension to data protection and cybersecurity amendments requirements.Similarly in Australia, a new rule has come in to force that requires all organizations with an annual turnover of AUS $3m ($1.93M) to disclose ransomware payments within 72 hours, including amount, currency, and timings of communications with the attackers.Via Infosecurity MagazineYou might also likeTake a look at the best antivirusI've rounded up the best password managersCritical milestone: how new SEC rules affect business cybersecurity

The iPhone 17 may not get a chipset upgrade, according to a noted analystBut a smaller and more efficient Dynamic Island could be added insteadOther iPhone 17 models are expected to get chipset upgradesA noted industry analyst has suggested that the iPhone 17 might not get a processor upgrade, instead launching with the same chipset as the current-generation model.Jeff Pu, Apple analyst at equity research firm GF Securities, has suggested the next iPhone will skip the usual chipset upgrade and continue to use the A18 chipset found in the iPhone 16 and iPhone 16 Plus.If this tipoff turns out the be true, it’d be Apple’s second time launching a phone without a chipset upgrade. In 2022, the iPhone 14 and iPhone 14 Plus launched to mixed reactions when it was revealed that Apple had equipped both phones with the same A15 chipset found in the iPhone 13 and iPhone 13 mini.As PhoneArena reports, the iPhone 17 could be the only iPhone 17 launch model to come with an A18 chipset – the iPhone 17 Pro and iPhone 17 Pro Max are both expected to get the A19 Pro chipset, while the new iPhone 17 Air is tipped to get the A19.Minor design differencesWhile the iPhone 17 Pro is tipped to get a design overhaul (Image credit: Front Page Tech / @asherdipps‬)So, is Apple in for a second round of side-eye from critics and customers? Maybe. If the latest iPhone 17 rumors are to be believed, Apple’s next base-model flagship will be the only one not to get some kind of major redesign with this year’s series.The iPhone 17 Pro and Pro Max are expected to get large camera bars a la the Google Pixel 9, and the iPhone 17 Air is tipped to get a new thin-and-light chassis with a single camera.That would leave the regular iPhone 17 as the only one of its series without some kind of design update, drawing even more attention to its similarities to last year’s model.A new Dynamic Island?The iPhone 17 Pro is tipped to get a smaller Dynamic Island (Image credit: Apple)Separate rumors suggest that the next vanilla could at least benefit from a Dynamic Island upgrade coming to the entire iPhone 17 lineup.Prior hints from Jeff Pu pointed to a reduced Dynamic Island using a metalens for Face ID, meaning a lens that compacts the transmitter and receiver into one component. As MacRumors reports, the suggestion was shared in an investor note issued by Pu earlier this month.However, fellow Apple analyst and well-regarded tipster Ming-Chi Kuo said in January that they don’t expect much of a change when it comes to the size of the Dynamic Island.We're expecting the iPhone 17 series to launch later this year. Would you buy an iPhone 17 that doesn’t come with an upgraded chipset? Would a smaller Dynamic Island be enough of an update to its design? Let us know in the comments below.You might also likeI spent a week testing the Honor 400 Pro, and it's a powerful almost-flagship with some fancy AI tricksWhat’s your favorite Android phone of all time? Let us knowI’m an iOS loyalist – here’s why Android has never tempted me to switch

WhatsApp has stopped supporting a number of older Apple and Android devicesThe change came into effect on June 1 after a slight extension was granted by AppleNow, WhatsApp will only work on devices running on iOS 15 and Android 5.0 and above, pushing users of older models to upgrade WhatsApp has officially dropped support for another wave of iPhone and Android phones, effective from June 1. So, if you’re still using a pre-2014 iPhone or Android phone, now’s the time to consider upgrading – especially if WhatsApp is your go-to messaging service.As a result of the latest updates to its OS requirements, WhatsApp now only supports iPhones that run on iOS 15.1 and up, and Android devices running on Android 5.0 and up. Originally, this update was pinned for May 5 2025, however according to 9to5Mac an extension was granted by Apple to give users of older iOS devices to prepare for the change.As of June 1, WhatsApp no longer supports the following iOS and Android models:iPhone 5siPhone 6iPhone 6sGalaxy S IIIHTC One XSony Xperia ZSome reports have also listed the iPhone 6s, iPhone 6s Plus, and the iPhone SE (1st gen), but 9to5Mac says that as these models run on iOS 15.8.4 they’re expected to be supported for another year or two until WhatsApp’s next operating system review.WhatsApp has posted details of the update on its Help Center stating “every year we look at which devices and software are the oldest and have the fewest users. These devices also might not have the latest security updates, or might lack the functionality required to run WhatsApp”.This is your sign for that much-needed upgrade While this update won’t have any effect on users of the best iPhones and best Android phones, a surprising number of people will always be using older models, especially if they’re not particularly tech savvy.However, if you use WhatsApp and if you’re still rocking a pre-2014 iPhone or Android phone, now is probably a good time to treat yourself to that long-overdue upgrade, and there are plenty of new models to choose from.Check out our round-ups of the best mobile phone deals in the US and the best mobile phone deals in the UK, or, if you’re an iPhone devotee, our round-ups of the best iPhone deals in the US and best iPhone deals in the UK.You might also like WhatsApp just finally launched its much anticipated iPad appGoogle Messages is getting another wave of updates – here are 8 you can expect to see soonWhatsApp has just dropped these 9 new features – including 2 that I'm not happy about

A couple months have passed since Apple released the iPad Air (M3) and our position remains the same: It's the best iPad on the market for just about everyone. Now, it's also a much more accessible option.

A new Amazon sale sees Apple's 11-inch iPad Air with an M3 chip drop to $499 from $599. The 17 percent discount is available on the 128GB model with Wi-Fi capabilities and no AppleCare+. We gave the new iPad Air (M3) an 89 in our review, thanks, in part, to that M3 chip. Its single- and multi-core scores came in 16 percent higher compared to its predecessor when tested with Geekbench.

The iPad Air M3 also has a much better screen and multitasking abilities this time around. Plus, it's compatible with a much improved Magic Keyboard. The add-on is akin to the one you'd get with Apple's iPad Pro M4 while also dropping by $30 from the previous model. But, it will still cost you $269 for the 11-inch model and $319 for the 13-inch one.

Check out our coverage of the best Apple deals for more discounts, and follow @EngadgetDeals on X for the latest tech deals and buying advice.This article originally appeared on Engadget at https://www.engadget.com/deals/apples-m3-ipad-air-drops-to-a-record-low-price-133932775.html?src=rss

Looking for a different day?A new Quordle puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Monday's puzzle instead then click here: Quordle hints and answers for Monday, June 2 (game #1225).Quordle was one of the original Wordle alternatives and is still going strong now more than 1,100 games later. It offers a genuine challenge, though, so read on if you need some Quordle hints today – or scroll down further for the answers.Enjoy playing word games? You can also check out my NYT Connections today and NYT Strands today pages for hints and answers for those puzzles, while Marc's Wordle today column covers the original viral word game.SPOILER WARNING: Information about Quordle today is below, so don't read on if you don't want to know the answers.Quordle today (game #1226) - hint #1 - VowelsHow many different vowels are in Quordle today?• The number of different vowels in Quordle today is 4*.* Note that by vowel we mean the five standard vowels (A, E, I, O, U), not Y (which is sometimes counted as a vowel too). Quordle today (game #1226) - hint #2 - repeated lettersDo any of today's Quordle answers contain repeated letters?• The number of Quordle answers containing a repeated letter today is 1.Quordle today (game #1226) - hint #3 - uncommon lettersDo the letters Q, Z, X or J appear in Quordle today?• No. None of Q, Z, X or J appears among today's Quordle answers.Quordle today (game #1226) - hint #4 - starting letters (1)Do any of today's Quordle puzzles start with the same letter?• The number of today's Quordle answers starting with the same letter is 2.If you just want to know the answers at this stage, simply scroll down. If you're not ready yet then here's one more clue to make things a lot easier:Quordle today (game #1226) - hint #5 - starting letters (2)What letters do today's Quordle answers start with?• F• S• F• WRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.Quordle today (game #1226) - the answers(Image credit: Merriam-Webster)The answers to today's Quordle, game #1226, are…FUGUESYRUPFLACKWORSTI was really thrilled to get SYRUP today. I had the S and the R in the correct positions and the letter U in the wrong position, so I spent a while trying to remember words that began S-U-R (SURGE was the only one I could think of) before deploying the Y.Meanwhile, FUGUE is a word that’s cropped up before and always reminds me of the first season of Breaking Bad, while FLACK triggers thoughts of the brilliant soul artist Roberta Flack and her amazing version of Killing Me Softly With His Song. Hmmm, I wonder how many people have been killed by a song.How did you do today? Let me know in the comments below.Daily Sequence today (game #1226) - the answers(Image credit: Merriam-Webster)The answers to today's Quordle Daily Sequence, game #1226, are…PULSECABLEREIGNADOREQuordle answers: The past 20Quordle #1225, Monday, 2 June: THINK, BELLE, CRONE, BOULEQuordle #1224, Sunday, 1 June: POINT, MERIT, WHOOP, APHIDQuordle #1223, Saturday, 31 May: CRUMB, ELFIN, DRIER, QUITEQuordle #1222, Friday, 30 May: RAJAH, CAUSE, BLACK, ETUDEQuordle #1221, Thursday, 29 May: CRIER, DRAPE, STRUT, NEIGHQuordle #1220, Wednesday, 28 May: HELLO, BEADY, VIGIL, PURERQuordle #1219, Tuesday, 27 May: TWEET, RANGE, POPPY, RADARQuordle #1218, Monday, 26 May: BLEAT, HOWDY, ASIDE, SCOOPQuordle #1217, Sunday, 25 May: OCEAN, AMBER, PIPER, GLEANQuordle #1216, Saturday, 24 May: HUSKY, HEIST, FOGGY, POLARQuordle #1215, Friday, 23 May: SHIRE, GIANT, AWAIT, CAPERQuordle #1214, Thursday, 22 May: LOSE, GLOVE, STINT, EXCELQuordle #1213, Wednesday, 21 May: NOVEL, CHOSE, DIRTY, DONUTQuordle #1212, Tuesday, 20 May: DECOY, SHAKE, MAPLE, PURERQuordle #1211, Monday, 19 May: LINK, HANDY, DITCH, WAIVEQuordle #1210, Sunday, 18 May: QUACK, ROACH, PURGE, DOWNYQuordle #1209, Saturday, 17 May: STRIP, RANGE, UNITE, GEESEQuordle #1208, Friday, 16 May: SHEEP, SNUCK, DRIFT, BREAKQuordle #1207, Thursday, 15 May: PAINT, CROUP, PEDAL, FLUKEQuordle #1206, Wednesday, 14 May: FAVOR, METER, PICKY, MAKER

Looking for a different day?A new NYT Connections puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Monday's puzzle instead then click here: NYT Connections hints and answers for Monday, June 2 (game #722).Good morning! Let's play Connections, the NYT's clever word game that challenges you to group answers in various categories. It can be tough, so read on if you need Connections hints.What should you do once you've finished? Why, play some more word games of course. I've also got daily Strands hints and answers and Quordle hints and answers articles if you need help for those too, while Marc's Wordle today page covers the original viral word game.SPOILER WARNING: Information about NYT Connections today is below, so don't read on if you don't want to know the answers.NYT Connections today (game #723) - today's words(Image credit: New York Times)Today's NYT Connections words are…SHOWBOATTENNISIDWITCHCRAFTFRIENDSHIPSELF-CAREHUNKY-DORYPOSTUREOKLAWFINECHARMGRANDSTANDSWELLMEDICINESWAGGERNYT Connections today (game #723) - hint #1 - group hintsWhat are some clues for today's NYT Connections groups?YELLOW: Showing offGREEN: All goodBLUE: Worn on wristPURPLE: Linked by a word that “makes perfect”Need more clues?We're firmly in spoiler territory now, but read on if you want to know what the four theme answers are for today's NYT Connections puzzles…NYT Connections today (game #723) - hint #2 - group answersWhat are the answers for today's NYT Connections groups?YELLOW: BE OSTENTATIOUS GREEN: COPACETIC BLUE: KINDS OF BRACELETS PURPLE: THINGS YOU CAN PRACTICE Right, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Connections today (game #723) - the answers(Image credit: New York Times)The answers to today's Connections, game #723, are…YELLOW: BE OSTENTATIOUS GRANDSTAND, POSTURE, SHOWBOAT, SWAGGERGREEN: COPACETIC FINE, HUNKY-DORY, OK, SWELLBLUE: KINDS OF BRACELETS CHARM, FRIENDSHIP, ID, TENNISPURPLE: THINGS YOU CAN PRACTICE LAW, MEDICINE, SELF-CARE, WITCHCRAFTMy rating: EasyMy score: PerfectSeeing the words SHOWBOAT and GRANDSTAND in the grid immediately had me thinking of sports people who enjoy adding a touch of needless flair to what they do. This is very common in soccer, where showboating players can ignite or frustrate a crowd depending on the scoreline – a fancy stepover/nutmeg/backheel while losing is almost criminal, but while winning the same tricks will be lauded as magicial.I was thrilled to get the hard purple group today before the end, when you don’t actually need to guess it. But my SWAGGER took a hit as I’d conjured them together without really knowing why. I was thinking they were all things you can do to defend yourself, so it’s almost right. How did you do today? Let me know in the comments below.Yesterday's NYT Connections answers (Monday, June 2, game #722)YELLOW: EXPEDITION JOURNEY, ODYSSEY, QUEST, VOYAGEGREEN: HOLD DEAR ESTEEM, PRIZE, TREASURE, VALUEBLUE: WORDS WHOSE ONLY VOWEL IS "y" MYRRH, NYMPH, RHYTHM, SPHYNXPURPLE: NAMES ENDING IN "K" PLUS WORD FRANKINCENSE, JACKPOT, MARKDOWN, NICKNAMEWhat is NYT Connections?NYT Connections is one of several increasingly popular word games made by the New York Times. It challenges you to find groups of four items that share something in common, and each group has a different difficulty level: green is easy, yellow a little harder, blue often quite tough and purple usually very difficult.On the plus side, you don't technically need to solve the final one, as you'll be able to answer that one by a process of elimination. What's more, you can make up to four mistakes, which gives you a little bit of breathing room.It's a little more involved than something like Wordle, however, and there are plenty of opportunities for the game to trip you up with tricks. For instance, watch out for homophones and other word games that could disguise the answers.It's playable for free via the NYT Games site on desktop or mobile.

Looking for a different day?A new NYT Strands puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Monday's puzzle instead then click here: NYT Strands hints and answers for Monday, June 2 (game #456).Strands is the NYT's latest word game after the likes of Wordle, Spelling Bee and Connections – and it's great fun. It can be difficult, though, so read on for my Strands hints.Want more word-based fun? Then check out my NYT Connections today and Quordle today pages for hints and answers for those games, and Marc's Wordle today page for the original viral word game.SPOILER WARNING: Information about NYT Strands today is below, so don't read on if you don't want to know the answers.NYT Strands today (game #457) - hint #1 - today's themeWhat is the theme of today's NYT Strands?• Today's NYT Strands theme is… That's proprietary!NYT Strands today (game #457) - hint #2 - clue wordsPlay any of these words to unlock the in-game hints system.HACKCLASPPERKJAZZTIMEDRACISTNYT Strands today (game #457) - hint #3 - spangram lettersHow many letters are in today's spangram?• Spangram has 11 lettersNYT Strands today (game #457) - hint #4 - spangram positionWhat are two sides of the board that today's spangram touches?First side: left, 5th rowLast side: right, 6th rowRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Strands today (game #457) - the answers(Image credit: New York Times)The answers to today's Strands, game #457, are…VELCROJACUZZIKLEENEXPOPSICLECHAPSTICKSPANGRAM: TRADEMARKEDMy rating: EasyMy score: PerfectA relatively straightforward Strands today, with lots of interesting hint words to find amid the real ones.Proprietary products are things that have been produced by a particular company rather than a generic product. Confusion often occurs when that product becomes so successful that the product name replaces the name generic items in popular speech – such as Hoover instead of vacuum cleaner and, well, all of the products in today’s search.The companies behind these products are often incredibly vigilant over their misuse and around enforcing their trademark. When I became a journalist, I realised this when I used the word Biro in place of ballpoint pen and used a lower case b. Two days later I received a firm letter from the solicitors for Biro, requesting I didn't make the same mistake again.Once, when the written word was much more edited than it is today, mistakes like that were uncommon and a publication or website would spend time verifying if the hot tub in question was an actual Jacuzzi or Jacuzzi wannabe.Now, more often than not, the price of popularity is the loss of your capital letter and sharing your spotlight with your wannabe competitors.How did you do today? Let me know in the comments below.Yesterday's NYT Strands answers (Monday, June 2, game #456)PLUMCHERRYBEEFSTEAKHEIRLOOMJUBILEELUNCHBOXSPANGRAM: TOMATOWhat is NYT Strands?Strands is the NYT's not-so-new-any-more word game, following Wordle and Connections. It's now a fully fledged member of the NYT's games stable that has been running for a year and which can be played on the NYT Games site on desktop or mobile.I've got a full guide to how to play NYT Strands, complete with tips for solving it, so check that out if you're struggling to beat it each day.

As the promise of AI to rapidly reshape industries intensifies, the gap between having an understanding of AI capabilities and the skills to implement AI solutions continues to widen. This divide is particularly pronounced between senior leadership, who drive digital transformation, and frontline workers, who are expected to implement and adapt to these changes and use this technology in their everyday work.Recent research highlights the consequences of the AI skills gap, with one-third of UK employees feeling unprepared to adopt AI in the next one to three years. This disconnect between strategy and day-to-day execution on the ground is further underscored by the fact that 77% of UK tech workers admit to pretending they know more about AI than they actually do – illustrating the urgent need for organizations to bridge this gap and promote organization-wide AI literacy.To address this divide, businesses must move beyond top-down mandates and build AI literacy across their entire workforce. Let’s explore why its important to act now, and how to achieve this in a scalable and effective way.Why businesses need AI literacy nowAccording to the World Economic Forum’s 2025 Future of Jobs Report, 39% of current skills in the workforce will become outdated within the next five years, with skills gaps remaining the biggest obstacle to organizational preparedness for future markets. As AI transforms ways of working and skills gaps widen, organizations must act now to equip employees with the knowledge necessary to understand AI applications and leverage them effectively.First and foremost, businesses must recognize that AI literacy is no longer a nice-to-have, but a necessity. Employees need a foundational understanding of how AI works, where it adds business value and how it can be integrated into daily operations.AI has the power to enhance efficiency, streamline workflows and improve business operations, transforming organizations across industries. A key element to upskilling efforts beyond understanding general AI capabilities is equipping team members with the ability to identify the opportunities for AI. They should also focus on building the mindset and awareness required to use AI effectively.For IT professionals, understanding AI fundamentals, such as ethical use, large language modelling and data privacy, is crucial. But technical proficiency alone isn’t enough. Power skills, like critical thinking, communication, experimentation, curiosity and resilience, will be equally important for navigating complex environments and driving innovation. A combination of technical and power skills ensures employees can thrive in their current roles, adapt to evolving technologies and build skills for the future.To embed AI literacy across the entire organization, leadership must take an active role in championing AI literacy initiatives. Without visible executive support, companies risk fragmented adoption and widening disparities in AI understanding between senior leaders and frontline workers. AI must be embraced holistically across all levels, from the boardroom to the frontline.Assessing existing skillsetsWith concern over the AI skills gap growing, 66% of C-Suite executives plan to recruit external AI-skilled talent, while 34% intend to ‘build’ talent internally by training existing employees. This split reflects the broader challenge of staying competitive in a landscape where AI capabilities are impacting the business landscape at a rapid pace.However, as skill lifespans shorten, especially in areas like machine learning, generative AI and data science, businesses can’t solely rely on external hires to stay ahead. The pace of change means that today’s skills can quickly become outdated and hiring new talent each time a skill becomes obsolete is not sustainable or cost-effective. Instead, organizations should strike a balance between hiring new talent and investing in continuous learning and reskilling for existing teams.This starts by assessing the existing skillsets in their team. By conducting baseline evaluations, businesses can compare current skills against benchmarks to identify areas for improvement. This targeted approach ensures learning initiatives are relevant, measurable and aligned with strategic business goals, maximising resource efficiency and impact.Bringing existing employees along on this journey by assessing their existing AI skills and upskilling them appropriately will lead to deeper benefits beyond technical proficiency. This approach also boosts employee retention by demonstrating a clear investment in their growth while also improving the quality of and engagement in their work.Creating an AI literacy frameworkRather than relying on ad hoc training sessions, organizations should establish structured, strategic AI literacy programs that equip frontline workers with the knowledge and skills required to identify AI use cases and drive AI adoption. Building this requires a multifaceted approach to learning, including programs that provide access to foundational AI and data skills, but they are only one piece of the puzzle.Programs such as instructor-led sessions that contextualize AI within specific roles and industries and simulation-based learning allow employees to engage with realistic, AI-powered scenarios. By embedding these learning experiences into workforce development, organizations can future-proof their workforce with the skills needed for the AI revolution.Additionally, continuous learning and adaptability must be central to organizational culture, equipping employees with current and future required skilling opportunities, as technical skill lifespans shorten. Creating AI literacy frameworks ultimately helps teams stay ahead of technological shifts while building overall resilience.Achieving organization-wide AI literacyAI literacy is no longer just for tech teams. It’s a business imperative across the entire workforce. For businesses to reduce the AI skills gap, it becomes even more crucial to bridge the divide between senior leadership and frontline workers.By assessing existing skill sets, implementing comprehensive AI upskilling throughout the organization and fostering a culture of continuous learning, businesses can build an AI-ready workforce that is both prepared for and on board with their business strategy.We've featured the best productivity tool.This article was produced as part of TechRadarPro's Expert Insights channel where we feature the best and brightest minds in the technology industry today. The views expressed here are those of the author and are not necessarily those of TechRadarPro or Future plc. If you are interested in contributing find out more here: https://www.techradar.com/news/submit-your-story-to-techradar-pro