News

Another great streaming deal has hit the internet: one year of Peacock Premium is only $25 right now. Just use the code SPRINGSAVINGS at checkout to get $55 off the standard annual price of the Premium plan. Just note that this tier does include ads, and the deal runs through May 30.

Peacock is a decent platform and made our list of the best streaming services. It doesn't get the attention of Netflix or Disney+, but it's home to several nifty original shows. There's the AI-adjacent tomfoolery of Mrs. Davis and the Rian Johnson-made whodunnit Poker Face. It also airs several video game adaptations, like Knuckles and the surprisingly-decent Twisted Metal.

The big draw here, however, is likely the long-awaited spinoff of The Office, which is called The Paper. That one premieres in September and is a Peacock exclusive. The platform also signed an 11-year agreement with the NBA and that goes into effect this fall. The mobile app could be getting minigames and short-form vertical videos (like TikTok) in the near future.

There's one caveat. This subscription will automatically renew for $80 after the year runs out. Stay on top of scheduling if you want to cancel before then.

The Scranton documentary crew is heading to Toledo. #ThePaper arrives this September on Peacock. pic.twitter.com/Mzmbw7TBzF— Peacock (@peacock) May 12, 2025

Check out our coverage of the best streaming deals for more discounts, and follow @EngadgetDeals on X for the latest tech deals and buying advice.This article originally appeared on Engadget at https://www.engadget.com/deals/peacock-premium-deal-get-one-year-for-only-25-163231856.html?src=rss

Doctor Who season 2 – or season 15 for anyone who's watched the show since its 2005 revival – is almost over. With two episodes left before the legendary sci-fi series departs our screens once more, you'll want to know when this season's penultimate chapter will be released.Below, I'll tell you when season 2 episode 7, titled 'Wish World', will be available to watch. You'll also find a full release schedule for Doctor Who's latest season, which includes details on when its finale will arrive.What time can I watch Doctor Who season 2 episode 7?Doctor Who season 2's second-to-last episode will be available to stream on BBC One and BBC iPlayer (UK) and Disney+ (internationally) on Saturday, May 24.Depending on where you live, 'Wish World' will be released at different times. Here's a rundown on when you can watch via the BBC on British shores and Disney+, aka one of the world's best streaming services, if you live outside of the UK (NB: if you live in a country that isn't listed below, use one of the following times to work out when you can watch it).US – 12am PT / 3am ETUK – 8am BST (BBC iPlayer) / 7:10pm BST (BBC One)Australia – 5pm AESTCanada – 12am PT / 3am ETBrazil – 4am BRTIndia – 12:30pm ISTNew Zealand – 7pm NZSTJapan – 4pm JSTSingapore – 3pm SGTWhere can I stream Doctor Who season 2 episode 7?A post shared by Doctor Who (@bbcdoctorwho)A photo posted by on As I mentioned above, UK viewers can tune into BBC iPlayer or BBC One to catch 'Wish World'. If you want to avoid any major spoilers, I'd recommend watching it as soon as it's released on iPlayer. Otherwise, stay off social media so you don't have any big surprises ruined before you catch it in the evening on BBC One.As for the rest of the world, Disney+ is the only place you can stream Doctor Who's next episode. So, no matter whether you live in the US, Australia, or any other nation that's not the UK, you can watch the penultimate chapter of one of the best Disney+ shows' latest season on that platform.Doctor Who season 2 full episodic release scheduleMeet the Unholy Trinity.... Archie Panjabi joins #DoctorWho as legendary character the Rani! pic.twitter.com/byGN0vC1keMay 17, 2025Unless you've skipped to the end of this article, you'll know that 'Wish World' is the second-to-last episode of Doctor Who season 2.So, with only one chapter, titled 'The Reality War' left after this week's entry, when will episode 8 be available to watch? Read on to find out more:Doctor Who season 2 episode 1 – out nowDoctor Who season 2 episode 2 – out nowDoctor Who season 2 episode 3 – out nowDoctor Who season 2 episode 4 – out nowDoctor Who season 2 episode 5 – out nowDoctor Who season 2 episode 6 – out nowDoctor Who season 2 episode 7 – Saturday, May 24Doctor Who season 2 episode 8 – Saturday, May 31You might also like'What on earth? – Doctor Who fans react to confusing teaser image after Mrs Flood's identity was finally revealedThese are the best Disney+ movies to watch todayOr read more about all of the new Disney+ movies that have been released recently

Thales surveyed more than 3,000 IT experts about Generative AIThe researchers found plenty of concern about security Despite the worries, businesses are accelerating adoptionDespite seeing it as a major innovation driver, businesses are overwhelmingly concerned about the security threats of artificial intelligence (AI). This is according to the 2025 Thales Data Threat Report, the company’s annual report on the latest data security threats, trends, and emerging topics.Based on a survey of more than 3,100 IT and security professionals in 20 countries and across 15 industries, the Thales report found that nearly 70% of organizations view the rapid advancement of AI as their biggest security risk. Generative AI, which can create text and images from simple text prompts, is a particular concern.Drilling deeper into these ideas, integrity and trustworthiness issues emerge as major challenges. Almost two-thirds (64%) of the respondents worry about AI’s lack of integrity, while 57% cited ‘trustworthiness’ as a major challenge. Also, since different GenAI functions like training, inference, or content generation, depend on user-provided data, the respondents expressed their concerns about increasing exposure to data security risks.60% off for Techradar readersWith Aura's parental control software, you can filter, block, and monitor websites and apps, set screen time limits. Parents will also receive breach alerts, Dark Web monitoring, VPN protection, and antivirus.Preferred partner (What does this mean?)View DealCISA added the flaws to KEVRegardless of these worries, organizations are still accelerating their AI adoption, the report further explains, hinting that this puts them at unnecessary risk. In fact, a third of businesses are actively integrating GenAI into operations despite not ensuring full security of their systems. Spending on GenAI has become one of the key priorities for organizations, second only to cloud security.“The fast-evolving GenAI landscape is pressuring enterprises to move quickly, sometimes at the cost of caution, as they race to stay ahead of the adoption curve,” Eric Hanselman, Chief Analyst at S&P Global Market Intelligence 451 Research, said. “Many enterprises are deploying GenAI faster than they can fully understand their application architectures, compounded by the rapid spread of SaaS tools embedding GenAI capabilities, adding layers of complexity and risk.”Almost three-quarters (73%) of professionals reported investing in AI-specific security tools with either new or existing budgets, Thales’ report concluded.You might also likeThe dual face of AI security - are you ready?Take a look at our guide to the best authenticator appWe've rounded up the best password managers

The first device OpenAI is putting out with Jony Ive won't be a phone or a wearable and may not even have a screen at all, according to The Wall Street Journal. OpenAI chief Sam Altman reportedly talked about the company's plans to employees after announcing that it has purchased Ive's startup called io. The Journal said Altman told employees that they have "the chance to do the biggest thing [they've] ever done as a company."

Altman and Ive gave out clues for what the company's first device could be: They said it will be fully aware of its environment and the user's activities, that it will unobtrusive and could either be carried around in one's pocket or placed on a desk. The executives also believe that it's bound to become one of people's "core" devices after a laptop and a phone. According to the Journal, it won't be a phone and that one of Ive's and Altman's goals is to wean people off screens, which means it most likely wouldn't come with a display. Altman reportedly said that it won't be a pair of glasses, and Ive wasn't keen on building a product users can wear in the first place.

Whatever the device is, they intend on guarding specifics until it's time to release it in order to prevent their competitors from copying it. They're hoping to launch their new AI device late next year and are hoping to ship 100 million units "faster than any company has ever shipped 100 million of something new before." Ive's team, the Journal said, has been talking to vendors that can mass produce the device over the past four months.

OpenAI apparently started working with Ive's startup a year-and-a-half ago. The original plan was to have Ive's company build a product that uses OpenAI's technology, but they realized that it could become the primary way users will interact with OpenAI's generative AI models. And that is why OpenAI ended up acquiring the startup founded by Apple's former chief design officer for $6.5 billion. We'll have to wait and see whether the combination of Ive's design and OpenAI's tech is compelling enough to convince people to buy yet another device from a new category. A company called Humane, for instance, tried and failed to get people to purchase the Ai Pin, which it marketed "as a tiny replacement for smartphones." In February, the company disconnected all the Pins it had sold, leaving customers without access to all of its features.This article originally appeared on Engadget at https://www.engadget.com/ai/openais-first-device-with-jony-ive-reportedly-wont-be-a-phone-or-a-wearable-130024787.html?src=rss

At I/O 2025, nothing Google showed off felt new. Instead, we got a retread of the company's familiar obsession with its own AI prowess. For the better part of two hours, Google spent playing up products like AI Mode, generative AI apps like Jules and Flow, and a bewildering new $250 per month AI Ultra plan.

During Tuesday's keynote, I thought a lot about my first visit to Mountain View in 2018. I/O 2018 was different. Between Digital Wellbeing for Android, an entirely redesigned Maps app and even Duplex, Google felt like a company that had its pulse on what people wanted from technology. In fact, later that same year, my co-worker Cherlynn Low penned a story titled How Google won software in 2018. "Companies don't often make features that are truly helpful, but in 2018, Google proved its software can change your life," she wrote at the time, referencing the Pixel 3's Call Screening and "magical" Night Sight features.

What announcement from Google I/O 2025 comes even close to Night Sight, Google Photos, or, if you're being more generous to the company, Call Screening or Duplex? The only one that comes to my mind is the fact that Google is bringing live language translation to Google Meet. That's a feature that many will find useful, and Google spent all of approximately a minute talking about it.

I'm sure there are people who are excited to use Jules to vibe code or Veo 3 to generate video clips, but are either of those products truly transformational? Some "AI filmmakers" may argue otherwise, but when's the last time you thought your life would be dramatically better if you could only get a computer to make you a silly, 30-second clip.

By contrast, consider the impact Night Sight has had. With one feature, Google revolutionized phones by showing that software, with the help of AI, could overcome the physical limits of minuscule camera hardware. More importantly, Night Sight was a response to a real problem people had in the real world. It spurred companies like Samsung and Apple to catch up, and now any smartphone worth buying has serious low light capabilities. Night Sight changed the industry, for the better.

The fact you have to pay $250 per month to use Veo 3 and Google's other frontier models as much as you want should tell everything you need to know about who the company thinks these tools are for: they're not for you and I. I/O is primarily an event for developers, but the past several I/O conferences have felt like Google flexing its AI muscles rather than using those muscles to do something useful. In the past, the company had a knack for contextualizing what it was showing off in a way that would resonate with the broader public.

By 2018, machine learning was already at the forefront of nearly everything Google was doing, and, more so than any other big tech company at the time, Google was on the bleeding edge of that revolution. And yet the difference between now and then was that in 2018 it felt like much of Google's AI might was directed in the service of tools and features that would actually be useful to people. Since then, for Google, AI has gone from a means to an end to an end in and of itself, and we're all the worse for it.

Even less dubious features like AI Mode offer questionable usefulness. Google debuted the chatbot earlier this year, and has since then has been making it available to more and more people. The problem with AI Mode is that it's designed to solve a problem of the company's own making. We all know the quality of Google Search results has declined dramatically over the last few years. Rather than fixing what's broken and making its system harder to game by SEO farms, Google tells us AI Mode represents the future of its search engine.

The thing is, a chat bot is not a replacement for a proper search engine. I frequently use ChatGPT Search to research things I'm interested in. However, as great as it is to get a detailed and articulate response to a question, ChatGPT can and will often get things wrong. We're all familiar with the errors AI Overviews produced when Google first started rolling out the feature. AI Overviews might not be in the news anymore, but they're still prone to producing embarrassing mistakes. Just take a look at the screenshot my co-worker Kris Holt sent to me recently.

Kris Holt for Engadget

I don't think it's an accident I/O 2025 ended with a showcase of Android XR, a platform that sees the company revisiting a failed concept. Let's also not forget that Android, an operating system billions of people interact with every day, was relegated to a pre-taped livestream the week before. Right now, Google feels like it's a company eager to repeat the mistakes of Google Glass. Rather than trying to meet people where they need it, Google is creating products few are actually asking for. I don't know about you, but that doesn't make me excited for the company's future.This article originally appeared on Engadget at https://www.engadget.com/ai/googles-most-powerful-ai-tools-arent-for-us-134657007.html?src=rss

Since 2022, Fancy Bear was targeting logistics organizations in the westThe goal was to monitor foreign aid coming to UkraineCCTV cameras at border crossings were monitored, as wellFancy Bear, the infamous Russian state-sponsored threat actor, has been spying on “dozens” of organizations from Western and NATO countries, monitoring foreign aid moving into Ukraine. This is according to a joint cybersecurity advisory [PDF], published by 21 government agencies from the US, UK, Canada, Germany, France, Czech Republic, Poland, Austria, Denmark, and the Netherlands.As per the report, Fancy Bear (also known as APT28) targeted logistics providers, technology companies, and government organizations involved in transporting aid to Ukraine.All transportation modes were covered, including air, sea, and rail, and the organizations spanned different industries, from defense, to transportation, to maritime and air traffic management, and ultimately - to IT services.60% off for Techradar readersWith Aura's parental control software, you can filter, block, and monitor websites and apps, set screen time limits. Parents will also receive breach alerts, Dark Web monitoring, VPN protection, and antivirus.Preferred partner (What does this mean?)View DealCredential stuffingThe targeted companies were operating in Bulgaria, Czech Republic, France, Germany, Greece, Italy, Moldova, Netherlands, Poland, Romania, Slovakia, Ukraine, and the United States. What’s more, the hackers were also monitoring CCTV cameras on border crossings for the same purpose.To gain initial access, APT28 relied on credential guessing and brute-force attacks. They also ran spearphishing campaigns, and took advantage of software vulnerabilities.By leveraging CVE-2023-23397, they targeted Microsoft Exchange, Roundcube Webmail, and WinRAR, allowing them to infiltrate the systems. Finally, they went for corporate VPNs and vulnerable SQL databases, and after compromising a network, moved laterally with tools such as PsExec and Impacket.The attackers manipulated email mailbox permissions, and used Tor and VPNs to remain hidden while keeping tabs on sensitive communication.The Russo-Ukrainian conflict demonstrated just how much warfare has changed in recent years. Besides the usual fronts - land, sea, and air, cyberspace has become a major battleground, with hackers and cybercriminals on both sides targeting sensitive information, and critical infrastructure.The attack should “serve as a reminder that cyber-physical systems are now strategic targets for adversaries,” commented Andrew Lintell, General Manager, EMEA, at Claroty. “To combat this, organisations need full visibility into these environments and a risk-based approach to securing them. Many of these devices, such as security cameras, weren’t designed with modern threats in mind, so are increasingly vulnerable entry points.”Via The RegisterYou might also likeRussian hackers are attacking innocent companies to get access to their neighborsTake a look at our guide to the best authenticator appWe've rounded up the best password managers

Looking for a different day?A new NYT Connections puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Thursday's puzzle instead then click here: NYT Connections hints and answers for Thursday, May 22 (game #711).Good morning! Let's play Connections, the NYT's clever word game that challenges you to group answers in various categories. It can be tough, so read on if you need Connections hints.What should you do once you've finished? Why, play some more word games of course. I've also got daily Strands hints and answers and Quordle hints and answers articles if you need help for those too, while Marc's Wordle today page covers the original viral word game.SPOILER WARNING: Information about NYT Connections today is below, so don't read on if you don't want to know the answers.NYT Connections today (game #712) - today's words(Image credit: New York Times)Today's NYT Connections words are…STONEFIBERMARBLEEYELINERBLOWOUTMAKEUPPOUNDBASHNATUREGLASSESBLASTDRAMNEBULAOUNCECHARACTERRAVENYT Connections today (game #712) - hint #1 - group hintsWhat are some clues for today's NYT Connections groups?YELLOW: Going largeGREEN: Your dispositionBLUE: UK measurements PURPLE: Feline styleNeed more clues?We're firmly in spoiler territory now, but read on if you want to know what the four theme answers are for today's NYT Connections puzzles…NYT Connections today (game #712) - hint #2 - group answersWhat are the answers for today's NYT Connections groups?YELLOW: QUITE THE PARTYGREEN: ONE'S CONSTITUTIONBLUE: BRITISH IMPERIAL UNITS OF WEIGHT PURPLE: WHAT "CAT'S EYE" CAN BE USED TO DESCRIBERight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Connections today (game #712) - the answers(Image credit: New York Times)The answers to today's Connections, game #712, are…YELLOW: QUITE THE PARTY BASH, BLAST, BLOWOUT, RAVEGREEN: ONE'S CONSTITUTION CHARACTER, FIBER, MAKEUP, NATUREBLUE: BRITISH IMPERIAL UNITS OF WEIGHT DRAM, OUNCE, POUND, STONEPURPLE: WHAT "CAT'S EYE" CAN BE USED TO DESCRIBE EYELINER, GLASSES, MARBLE, NEBULAMy rating: EasyMy score: PerfectBRITISH IMPERIAL UNITS OF WEIGHT is something some people in the UK get bizarrely exercised over – or at least they did about 20 years ago, when greengrocers feared that measuring potatoes in kilograms would lead to the collapse of society, and bar owners fretted over serving 700ml of lager instead of a pint.For people like this, accepting the metric system was tantamount to surrendering to Hitler, Napoleon and Julius Caesar.Years on we remain in a weird limbo where things are measured in both British imperial and metric, where some people think they weigh 15 STONE and other people think they weigh 95kg. A similar inertia over the metric system exists in the US, but unlike the UK it’s not tied up in ONE’S CONSTITUTION.Meanwhile, the inclusion of MARBLE in WHAT "CAT'S EYE" CAN BE USED TO DESCRIBE puzzled me initially, as I was thinking of the marble stone rather than the marble game.How did you do today? Let me know in the comments below.Yesterday's NYT Connections answers (Thursday, May 22, game #711)YELLOW: FINE PRINT ASTERISK, CATCH, CONDITION, STRINGSGREEN: CHARACTERS WITH GREEN SKIN ELPHABA, GRINCH, HULK, SHREKBLUE: FEATURES OF THE NATIONAL MALL IN D.C. CAPITOL, MALL, OBELISK, POOLPURPLE: FAMOUS RIDDLE-GIVERS BRIDGE TROLL, MAD HATTER, RIDDLER, SPHINXWhat is NYT Connections?NYT Connections is one of several increasingly popular word games made by the New York Times. It challenges you to find groups of four items that share something in common, and each group has a different difficulty level: green is easy, yellow a little harder, blue often quite tough and purple usually very difficult.On the plus side, you don't technically need to solve the final one, as you'll be able to answer that one by a process of elimination. What's more, you can make up to four mistakes, which gives you a little bit of breathing room.It's a little more involved than something like Wordle, however, and there are plenty of opportunities for the game to trip you up with tricks. For instance, watch out for homophones and other word games that could disguise the answers.It's playable for free via the NYT Games site on desktop or mobile.

Looking for a different day?A new NYT Strands puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Thursday's puzzle instead then click here: NYT Strands hints and answers for Thursday, May 22 (game #445).Strands is the NYT's latest word game after the likes of Wordle, Spelling Bee and Connections – and it's great fun. It can be difficult, though, so read on for my Strands hints.Want more word-based fun? Then check out my NYT Connections today and Quordle today pages for hints and answers for those games, and Marc's Wordle today page for the original viral word game.SPOILER WARNING: Information about NYT Strands today is below, so don't read on if you don't want to know the answers.NYT Strands today (game #446) - hint #1 - today's themeWhat is the theme of today's NYT Strands?• Today's NYT Strands theme is… The musical fruitNYT Strands today (game #446) - hint #2 - clue wordsPlay any of these words to unlock the in-game hints system.BEGINDINTLANEBAITDINKREEKNYT Strands today (game #446) - hint #3 - spangram lettersHow many letters are in today's spangram?• Spangram has 9 lettersNYT Strands today (game #446) - hint #4 - spangram positionWhat are two sides of the board that today's spangram touches?First side: top, 3rd columnLast side: bottom, 5th columnRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Strands today (game #446) - the answers(Image credit: New York Times)The answers to today's Strands, game #446, are…FAVAKIDNEYBLACKGREENNAVYCANNELLINISPANGRAM: BEAN SALADMy rating: EasyMy score: PerfectThe biggest challenge today was working out how to spell CANNELLINI. Other than that, this was one of the fastest games of Strands I’ve ever played – maybe because I eat so many beans.I immediately knew what we were looking for from the theme “the musical fruit” as, well, beans do have a reputation of causing people to perform a few bum notes. The way to avoid this is to use dry beans that have been soaked overnight in a pinch of salt, but that’s quite a palaver if you’re just a casual BEAN SALAD chomper.As to the argument over the classification of beans, the answer is that technically, beans are a type of fruit, specifically a legume. However, they are often categorized as vegetables and you’re unlikely to find them hanging out with bananas.How did you do today? Let me know in the comments below.Yesterday's NYT Strands answers (Thursday, May 22, game #445)STEWARDGUARDIANPROTECTORCUSTODIANTRUSTEESPANGRAM: TAKE CAREWhat is NYT Strands?Strands is the NYT's not-so-new-any-more word game, following Wordle and Connections. It's now a fully fledged member of the NYT's games stable that has been running for a year and which can be played on the NYT Games site on desktop or mobile.I've got a full guide to how to play NYT Strands, complete with tips for solving it, so check that out if you're struggling to beat it each day.

Looking for a different day?A new Quordle puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Thursday's puzzle instead then click here: Quordle hints and answers for Thursday, May 22 (game #1214).Quordle was one of the original Wordle alternatives and is still going strong now more than 1,100 games later. It offers a genuine challenge, though, so read on if you need some Quordle hints today – or scroll down further for the answers.Enjoy playing word games? You can also check out my NYT Connections today and NYT Strands today pages for hints and answers for those puzzles, while Marc's Wordle today column covers the original viral word game.SPOILER WARNING: Information about Quordle today is below, so don't read on if you don't want to know the answers.Quordle today (game #1215) - hint #1 - VowelsHow many different vowels are in Quordle today?• The number of different vowels in Quordle today is 3*.* Note that by vowel we mean the five standard vowels (A, E, I, O, U), not Y (which is sometimes counted as a vowel too). Quordle today (game #1215) - hint #2 - repeated lettersDo any of today's Quordle answers contain repeated letters?• The number of Quordle answers containing a repeated letter today is 1.Quordle today (game #1215) - hint #3 - uncommon lettersDo the letters Q, Z, X or J appear in Quordle today?• No. None of Q, Z, X or J appear among today's Quordle answers.Quordle today (game #1215 - hint #4 - starting letters (1)Do any of today's Quordle puzzles start with the same letter?• The number of today's Quordle answers starting with the same letter is 0.If you just want to know the answers at this stage, simply scroll down. If you're not ready yet then here's one more clue to make things a lot easier:Quordle today (game #1215) - hint #5 - starting letters (2)What letters do today's Quordle answers start with?• S• G• A• CRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.Quordle today (game #1215) - the answers(Image credit: New York Times)The answers to today's Quordle, game #1215, are…SHIREGIANTAWAITCAPERThis was a no-hesitation, “first thought best thought” round for me, where I went with the first word that came into my head. Of course, breezing through games like this quickly has more to do with playing Quordle a lot than any actual skills, as all these words have appeared in the game before.How did you do today? Let me know in the comments below.Daily Sequence today (game #1215) - the answers(Image credit: New York Times)The answers to today's Quordle Daily Sequence, game #1215, are…DRAPEPRANKVALUESWELLQuordle answers: The past 20Quordle #1214, Thursday, 22 May: LOSE, GLOVE, STINT, EXCELQuordle #1213, Wednesday, 21 May: NOVEL, CHOSE, DIRTY, DONUTQuordle #1212, Tuesday, 20 May: DECOY, SHAKE, MAPLE, PURERQuordle #1211, Monday, 19 May: LINK, HANDY, DITCH, WAIVEQuordle #1210, Sunday, 18 May: QUACK, ROACH, PURGE, DOWNYQuordle #1209, Saturday, 17 May: STRIP, RANGE, UNITE, GEESEQuordle #1208, Friday, 16 May: SHEEP, SNUCK, DRIFT, BREAKQuordle #1207, Thursday, 15 May: PAINT, CROUP, PEDAL, FLUKEQuordle #1206, Wednesday, 14 May: FAVOR, METER, PICKY, MAKERQuordle #1205, Tuesday, 13 May: SCENT, AGAPE, POLAR, YEARNQuordle #1204, Monday, 12 May: ROYAL, ARGUE, BUNCH, READYQuordle #1203, Sunday, 11 May: QUASH, MUNCH, ALTER, UNDUEQuordle #1202, Saturday, 10 May: RELIC, BADGE, CHAMP, SATINQuordle #1201, Friday, 9 May: MINUS, CRIME, NOSEY, SLAINQuordle #1200, Thursday, 8 May: ELUDE, GREET, POPPY, ELITEQuordle #1199, Wednesday, 7 May: QUOTH, TRUNK, BESET, NAIVEQuordle #1198, Tuesday, 6 May: UNITE, SOGGY, FILET, PORCHQuordle #1197, Monday, 5 May: WREAK, COWER, STEAD, QUEUEQuordle #1196, Sunday, 4 May: PINCH, SMOKE, SCARY, CANNYQuordle #1195, Saturday, 3 May: PLUSH, VERGE, WROTE, CONDO

Community and mid-size banks are the bedrock of local economies, but in today’s hyper-connected world, they are increasingly finding themselves on a dangerous digital battleground. While large financial institutions deploy formidable cyber defenses, smaller banks often grapple with limited resources, making them attractive targets for cybercriminals wielding ever more sophisticated weapons. Recent cybersecurity analyses reveal critical vulnerabilities and trends that demand immediate attention if these essential institutions are to protect their assets and maintain customer trust.The compliance trap: reacting instead of preventingOne major hurdle is a tendency to prioritize reacting to breaches over proactively preventing them. In the heavily regulated banking sector, compliance with data breach notification rules is nonnegotiable. However, an overemphasis on ticking these post-incident boxes can divert critical resources and focus away from building robust, preventive security measures.Neglecting fundamentals like comprehensive data encryption or rigorously tested incident response plans is like meticulously planning a fire escape route while forgetting to install smoke detectors — the focus is on the aftermath, not avoiding the fire itself. This reactive stance leaves banks perpetually vulnerable, always a step behind the attackers.Third-party peril: the outsourced Achilles’ heelThe growing reliance on third-party vendors for IT functions, cybersecurity, and cutting-edge fintech solutions presents another significant risk. These partnerships offer expertise and scalability, but they also widen the potential attack surface. Worryingly, studies show a frequent lack of rigorous due diligence and ongoing oversight of these critical partners.Banks may fail to thoroughly vet vendor security practices, secure strong contractual safeguards, or clearly define liability in the event of a breach originating from a third party. As sensitive customer data flows to external entities, ensuring vendors meet the same stringent security standards is paramount. Ultimately, the regulatory buck stops with the bank, making robust third-party risk management an underdeveloped but absolutely critical defense.Calling for backup: bridging the expertise gapThe cyber threat landscape shifts constantly, with new attack vectors and complex regulations emerging at breakneck speed. Many community banks lack the dedicated in-house expertise to keep pace. This is where external cybersecurity specialists and legal counsel become invaluable allies.Yet there is often an underutilization of this crucial support. Engaging seasoned experts provides vital guidance for developing comprehensive security programs, conducting realistic risk assessments, navigating compliance requirements, and effectively preparing for — and responding to — inevitable incidents.Furthermore, involving legal counsel early can establish attorney-client privilege, offering essential protection during sensitive investigations or potential litigation. Ignoring this available expertise is like going into battle without all your available reinforcements.The AI double-edged sword: hesitation and heightened threatsWhile banking giants increasingly harness artificial intelligence (AI) for advanced threat detection, fraud prevention, and anomaly identification, many community banks remain hesitant. Concerns about cost, complexity, and integration challenges are understandable, but this reluctance creates a widening gap in cyber resilience.This hesitation is doubly dangerous because cybercriminals are embracing AI, using it to craft hyper-personalized phishing scams, automate attacks at unprecedented speed and scale, and develop malware designed to evade traditional defenses.The AI threat to community banks is stark:Supercharged Social Engineering: AI crafts phishing emails and scams with uncanny personalization, making them harder for employees and customers to spot.Rapid Automated Attacks: AI enables attackers to scan for weaknesses and launch assaults faster than banks with limited monitoring can react.Evasive Malware: AI-driven malware can learn and adapt, potentially bypassing conventional security tools.“Swimming Away” Risk: As larger banks fortify themselves with AI, less-protected community banks become comparatively easier and more attractive targets.The resource realityUnderpinning all these challenges is the fundamental reality of limited resources. Compared to their larger counterparts, community banks often struggle to fund cutting-edge security tech, hire specialized cyber defenders, or implement extensive, ongoing training. Employees frequently wear multiple hats, potentially diluting the focus needed for dedicated cybersecurity and third-party risk oversight.Fortifying the front lines: a call for proactive defenseThe message is clear: community banks face a formidable and evolving cyber threat. Weathering this storm requires a fundamental shift from reactive compliance to proactive, layered defense.This means prioritizing robust preventive measures, implementing rigorous third-party vendor management, strategically leveraging external expertise, and thoughtfully engaging with new technologies like AI — understanding both their defensive potential and the threats they introduce.By acknowledging vulnerabilities and taking decisive, strategic action, community banks can build stronger digital fortresses, safeguard their customers’ trust, and secure their vital role in our financial ecosystem.We've featured the best encryption software.This article was produced as part of TechRadarPro's Expert Insights channel where we feature the best and brightest minds in the technology industry today. The views expressed here are those of the author and are not necessarily those of TechRadarPro or Future plc. If you are interested in contributing find out more here: https://www.techradar.com/news/submit-your-story-to-techradar-pro

When times are tough, the instinct of many executives is to squeeze existing assets: make platforms do more with less, reduce the total cost of ownership, and extract value through cuts.One study found that 76% of CFOs said that challenging market environments increase pressure on them to drive cost efficiencies and hit short-term earnings targets. Those cuts can involve funding for long-term priorities; the same study found that 50% of finance leaders aimed to meet short-term targets by reducing investment in areas such as Environmental, Social and Governance (ESG).It is the sort of approach taken from a playbook that’s been deployed in any major economic downturn, and in many ways, it feels a bit antiquated; nascent sustainability initiatives were some of the first cuts in 2008, for example.Those companies that take this approach diminish the impact it can have on maintaining competitiveness in the medium and longer term. While it is easier to agree on a tactic that has previously generated the desired results, operating predominantly in the short term can leave businesses constantly reacting. This, in turn, limits their ability to be ahead of the competition.Finally, there is only so much that can be cut.But what if there was an alternative that could not only get more from existing investments, but provide a foundation for future innovation?Turning to the circular economy for inspirationThis alternative is embedded in the circular economy. It is about a shift in mindset and approach that focuses on building extensible, modular, and low-waste digital platforms that evolve, rather than ripping and replacing every 18 months.It draws from the circular economy, combining a commitment to sustainability with innovation and smarter design principles to create new value. It is a marked shift away from planned obsolescence; instead, the focus is on creating products and services that embody longevity.The circular economy already draws heavily on technology to enable its operations.For instance, companies like Rheaply and Too Good To Go provide digital marketplaces to connect those with resource needs to those with excess resources.Rheaply was originally set up to link scientists with underutilized lab equipment and consumables and has helped organizations recapture $4.1 million in value in the last year.Too Good To Go allows restaurants and retailers to sell unwanted food to consumers. An app allows customers to browse parcels of surplus, while a B2B platform helps food companies track, manage and distribute their goods.Then there are those businesses that are taking the principles of the circular economy and embedding them into digital products.For example, modular consumer electronics that can be repaired, that don’t struggle when new updates are pushed to them, and as a result last for far longer than industry averages. Fairphone, in the Netherlands, is one such manufacturer, producing smartphones and headphones that combine recycled materials with extended warranty and repair packages.Embedding digital circular economy principles into product lifecyclesThese approaches are not limited to businesses dealing in physical assets, either. Inspired by the principles of the circular economy, product teams can reduce tech debt, increase longevity and cut costs, without compromising on speed and performance.This is achievable with a strategy that is biased for modularity, human centered design and a focus on releasing minimum lovable products (MLP) over minimum viable products (MVP), with continual iteration. It is about integrating circularity and long-term fitness into everything a team develops.Specifically, that includes:Investing upfront to avoid downstream waste: A well-structured discovery phase prevents over-engineering and cuts both delivery time and long-term complexity.Embedding extensibility from day one: No one can predict what the future will bring, but efforts must be made to future-proof where possible. Using open APIs and scalable frameworks enables growth without costly refactoring later.Going modular, not monolithic: Designing in interchangeable modules allows for targeted upgrades and reduces the need for full rebuilds, extending the life of each component.Use smaller, cross-functional squads to stay lean and focused: Small teams reduce coordination overhead, speed up decision-making, and avoid layering in unnecessary processes or tech.Combine bespoke and off-the-shelf: Cloud-native and low-code platforms offer speed and savings, without sacrificing reliability, and can be augmented with custom tools for specific use cases.Treat sustainability as a design constraint: Restrictions fuel creativity, which can lead to fantastic design solutions. Challenging teams to think about what the lowest waste path to value is at each stage of the product life cycle helps decision-making that will cut carbon and costs.Lean and focus over sprawling and wastefulAt its heart, sustainability is about optimizing resources, with no waste. That is what implementing digital circular economy approaches do; they are a constant process of making use of what is available to extract maximum value, with little to no waste. It is sustainability that pays for itself.That includes looking at the teams developing products and services. Large teams with multiple layers can feel safe, but they can also be bloated, over-engineering for the sake of it. Smaller teams can reduce time-to-value, strip out excess and deliver modular builds that are easier to extend, maintain and evolve.Small does not mean under-resourced; it removes the opportunity to become unfocused, sprawling and wasteful.Combatting economic pressures with digital circular economy principlesThere is no doubt that executives are facing significant economic pressures. The tendency will be to cut, but in doing so, there is a risk of waste and, more importantly, losing competitive advantage in both the mid- and long-term.Instead, there is an opportunity to reframe the situation, to still do more with less, but in a way that does not sacrifice future objectives.Turning to the digital circular economy means unlocking opportunities with products and services that really do extract every ounce of value. In doing so, companies will not only secure their future, but they’ll be better set up to achieve a form of growth that allows them as businesses to be both profitable and sustainable.We've featured the best green web hosting.This article was produced as part of TechRadarPro's Expert Insights channel where we feature the best and brightest minds in the technology industry today. The views expressed here are those of the author and are not necessarily those of TechRadarPro or Future plc. If you are interested in contributing find out more here: https://www.techradar.com/news/submit-your-story-to-techradar-pro

It’s not often that two of the biggest names in tech get together to "completely reimagine what it means to use a computer”, but that’s what’s happened when Sam Altman’s OpenAI bought Jony Ive’s io design company recently and announced that they would be creating some new AI products together.Jony Ive is perhaps most famous for designing the iPhone, and Sam Altman is the driving force behind ChatGPT, so my mind immediately hopped to the idea of the world’s first ChatGPT-powered smartphone, but it turns out that Ive and Altman have got something else in mind. Something that we might have seen before.It was all revealed in a nine-minute video that OpenAI released yesterday called Sam and Jony introduce io:The video starts with Altman saying, “I think we have the opportunity here to kind of completely reimagine what it means to use a computer”.According to Ive, io is "formed with a mission of creating a family of devices that would let people use AI to create all sorts of wonderful things”. The video goes on to mention a new prototype of Ive’s that Altman has been testing.Altman calls it “the coolest piece of technology that the world has ever seen”, but frustratingly doesn’t go into any details about it, although clues are littered throughout the video.For example, in one segment, he talks about how cumbersome the process of using a laptop is because it has a screen.It’s hard not to get swept up in the reality distortion field that surrounds these tech gurus, but creating an AI computer with no screen essentially means something small that you wear or carry around with you and interact with using your voice, and that concept has so far scuppered more than one tech startup.Of course, I’m referring to the now legendary tech failures that are the Humane AI Pin and the Rabbit R1.Inspired by Star Trek? Wearing the Humane AI Pin (Image credit: Humane)Beam me up ScottyThe Humane AI Pin was basically like the classic Star Trek combadge. It clipped onto your clothing and stayed there in standby mode until you engaged with it. It was ahead of its time in many respects - you could ask it questions (like an AI-powered Siri or Alexa) and get it to play music. It also had a camera, so it could see what you were looking at and answer questions about it. It could also shoot out a laser onto your palm that brought up a menu system that you could interact with using hand gestures.The Rabbit R1 was similar, except it was designed to fit your pocket, not be worn on your chest.They were both good ideas, and ahead of their time, but good ideas don’t automatically turn into good products. They were each flawed in some fundamental ways.Here are five classic mistakes that people have already made with AI devices that Ive and Altman will need to avoid:1. Sometimes you do need a screenThe Humane AI Pin was built around the idea of replacing your smartphone, but that was never going to work.In theory, combining the power of sophisticated AI and the entire Internet, in a way that means you could still be completely present in the moment and not bogged down by intrusive and addictive phone applications, was a good idea. In practice, it just didn’t work.We live in a world where everybody has already got a smartphone, so if you want to interact with other people, who are all using screens and sharing visual information, then you are going to have to use a screen at some point.Whether that means that the io device can co-opt the existing screens in your life, or it can attach to a screen in some way, I don’t know, but remembering that screens are still essential for some things will be key to its success.2. It can't be too expensiveThis is going to be key to the device's adoption. A major criticism of the AI devices released so far is that they were too expensive. We already have an expensive smartphone and a data plan to go with it, please don’t expect us to be able to afford an equally priced second device and a second data plan each month.Jony Ive gave us the iPhone and the MacBook Pro - devices that defined technology for a generation, but those products have always had a premium price tag.The man may be a genius, but if this product is to succeed, it needs a price point that makes sense, not one that alienates its target audience.Jony Ive and Sam Altman (Image credit: OpenAI)3. The voice interaction has to be flawlessAI voice modes, particularly ChatGPT's Advanced Voice mode and Gemini Live, have come a long way in recent months. They feel a lot more natural to use, as if you are having a real conversation with a friend.Delivering that experience with the new io device will be key to its success. If conversation with the AI is stilted in any way or if there are long pauses after you tell it to do something – a problem that has plagued previous AI devices – then it’s not going to take off.The whole experience of using it will need to be as frictionless as possible.4. It can't hallucinate at allAI has a tendency to make stuff up, which is known as hallucinating, and it’s a problem that seems to be getting worse the smarter the AI gets.According to its own reports, ChatGPT’s new o3 model incorporated hallucinations in a third of a benchmark test involving public figures, which is double the error rate of the earlier o1 model. The compact o4-mini model performed even more badly, hallucinating on 48% of similar tasks.One theory that explains why AI is getting worse at hallucinating is that the deeper the reasoning method goes, the greater the chance it has to mess up. The older, simpler models stuck to higher-confidence predictions, unlike today’s complex models. When there are multiple paths to consider, the model has a greater chance of improvising and getting things wrong.Whatever the issue, the Humane AI Pin, which could use any AI model, certainly hallucinated, and there needs to be no trace of the problem in any product released by io if it wants to be trusted.5. It needs to work without an internet connectionThis will be a tough one to implement for sure, but requiring a second data plan just for the device was one of the major problems with the Humane AI Pin. Without access to the Internet, it was useless. Perhaps the new io devices will be able to piggyback off your phone’s Internet connection, but ideally, they’d also be capable of some on-device processing, meaning that they could continue to function even in places where there’s no data coverage.Back on May 7, Apple Exec Eddy Cue let slip that “you may not need an iPhone 10 years from now” whilst giving testimony at the Google Search antitrust remedies trial. Clearly, the time is ripe for some kind of AI device, and the possibilities for reimagining a human and computer interaction are endless, but as we’ve seen, others have gone down this road before, and so far, it’s not ended well. Let’s hope that whatever io releases in 2026 (its promised delivery date for its family of AI products) can buck this trend because nobody wants to see another doomed AI device hit the market.You may also likeSam Altman and Jony Ive’s mysterious ‘AI-powered computer’ will be OpenAI’s magnum opus - here are 5 clues that hint at what it will beGoogle Gemini 2.5 Flash promises to be your favorite AI chatbot, but how does it compare to ChatGPT 4o?I pitched the new Google Gemini against ChatGPT for AI image generation – and the results shocked me

The DoJ announced seizing multiple domains used by Lumma StealerThe infostealer is linked to some of the biggest cyberattacks in recent timesThe malware caused millions of dollars in damagesThe US Department of Justice, together with the FBI and Microsoft, disrupted the operations of Lumma Stealer, one of the biggest information-stealing malware variants out there.In a press release published on the DoJ’s website earlier this week, it was explained that the law enforcement agencies seized five internet domains that were used to deploy LummaC2. The threat actors tried to relocate their operations and set up three new domains, which were quickly picked up by the DoJ, as well.Furthermore, Microsoft independently took down 2,300 additional internet domains linked to LummaC2’s criminal activities.Save up to 68% on identity theft protection for TechRadar readers! TechRadar editors praise Aura's upfront pricing and simplicity. Aura also includes a password manager, VPN, and antivirus to make its security solution an even more compelling deal.Preferred partner (What does this mean?)View DealHigh-profile attacksLumma Stealer is a popular infostealer that grabs sensitive information such as login credentials, browser autofill information, and cryptocurrency wallet data. It is usually distributed through malicious websites and phishing campaigns, and was seen in numerous high-profile cyberattacks. The seized domains were used by different cybercriminals to access, and later deploy, the infostealer.The FBI said the malware was used in at least 1.7 million instances since late 2023, and resulted in roughly 10 million infections. These infections resulted in losses of more than $36 million in 2023 alone. The DoJ is now offering a bounty of $10 million for information on cyberattacks against US infrastructure, conducted by foreign state-sponsored threat actors.Lumma was involved in many high-profile cybercriminal cases, including the attack against Schneider Electric that happened in early November 2024. In that instance, researchers from Hudson Rock found, the criminals behind the attack claimed to have stolen “critical data”, including projects, issues, and plugins, along with 400,000 rows of user data, totaling more than 40GB compressed data.The same infostealer was apparently also used to steal credentials that were later leveraged to break into people’s Snowflake cloud storage accounts, triggering one of the bigger supply chain attacks in recent times.Via The RegisterYou might also likeSchneider Electric says developer platform was breached, company data stolenTake a look at our guide to the best authenticator appWe've rounded up the best password managers

A well-known leaker has said Apple’s 18.8-inch foldable is still inbound possibly as early as 2027Amazon also has a ‘similar’ large foldable in the pipeline, thoughWith Huawei recently airing a foldable laptop, Apple may feel it’s falling behind rivals – and we still don’t even know the exact nature of its deviceApple’s rumored big foldable device – which might be a MacBook that’s all-screen and no physical keyboard, or a huge iPad tablet – has popped up on the grapevine once again with a claim that it could be here in 2027. However, Amazon might beat Apple to the shelves here, we’re told.As Wccftech noticed, renowned Apple leaker Ming-Chi Kuo posted on X to let us know that Apple’s 18.8-inch foldable is still set to go into mass production in either late 2027 or 2028 (a timeframe he’s previously mentioned, and I’ll return to that point later).Apple's competitors in the large-sized foldable device market may not be limited to Huawei. My research indicates that Amazon is also internally developing a similar product, which has not yet officially kicked off. If development progresses as planned, it is projected to enter…May 20, 2025This comment came after Huawei revealed its MateBook Fold laptop at Computex 2025 earlier this week, which is an 18-inch device, so very similar in size to Apple’s theoretical product here. (I should note that both this and the rumored Apple foldable are 18 to 19-inches when fully unfolded, so that’s the total size of the device).Kuo further observed that Amazon is developing a “similar product” which has yet to be made official, but it could be due to hit the production lines in late 2026, or perhaps 2027 (add plenty of seasoning with all of this).Analysis: Falling behind rivals?(Image credit: Future / Lance Ulanoff)The hint being dropped here, then, is that Apple is falling behind the pacemakers in the giant foldable device arena, with Amazon’s timetable apparently being a year in advance of Apple’s. Although that said, for something which isn’t even officially underway yet, the Amazon device debuting at the close of next year seems like a pretty fast track through development.The key question, of course, is will Apple be producing an 18.8-inch foldable MacBook or iPad? (Incidentally, if a foldable laptop seems like an odd term – and it is, given that all notebooks fold up – it refers to a folding screen, rather than chassis. This is a notebook that doesn’t have a keyboard, and instead uses a virtual keyboard displayed on one half of the screen).This is where things get a bit odd as rumors have suggested Apple’s foldable device could be either a laptop or tablet. Kuo comparing it to Amazon’s foldable – which is surely a Fire tablet – would seem to suggest it’s a huge iPad. But then a direct comparison is also made to Huawei’s foldable laptop. Furthermore, the leaker notably uses the neutral term ‘device’ rather than any hint of mentioning a laptop or tablet.What that suggests to me is that Apple is working through concepts on both sides of the fence, tablet and laptop, and still hasn’t made the decision of which OS to go with, macOS or iPadOS, and what’ll be more useful: a MacBook with a folding screen (and virtual keyboard), or an iPad that can fold out to be a giant display.Personally I think the MacBook idea is the frontrunner (and rumors about Apple working on a notebook with a virtual keyboard have been around for ages). Although more innovative and attention-grabbing, that is the riskier move, admittedly, in terms of getting Mac fans to accept the ditching of a physical keyboard in favor of a screen-based effort. It’d have to be a very good virtual keyboard, that’s for sure. A big iPad would be a safer avenue to tread when you look at these ideas in that light.What’s also interesting is that Kuo hasn’t changed the release timeframe for this 18.8-inch foldable since talking about it in mid-2024, which could be read as Apple being on track with its development schedule here. Or Kuo simply hasn’t heard anything else, especially regarding that decision on whether to make the hardware a laptop or tablet.All in all, that’s a bit of a worry, but if this large foldable device really is coming from Apple, we should receive some firmer hints soon enough. And it’s certainly true that plans from rival laptop (or tablet) makers will help spur Apple’s thought processes and the realization of this product, or I’d imagine so, anyway.You might also likeMacBooks are now legitimate gaming machines – and the future looks promisingI’ve been reviewing Dell laptops for years, and I'm still shocked at how much I like the Dell 14 PlusCan’t upgrade to Windows 11? This Linux project wants to save your old PC from the scrapheap when Windows 10 support ends

Capcom announces a new Monster Hunter Wilds and Street Fighter 6 collaboration eventThe special collab releases on May 28 and will feature a new side quest and Street Fighter 6 rewards, including an Akuma layered armor setAdditional paid Street Fighter 6 DLC will be released the same dayCapcom has unveiled its Monster Hunter Wilds special collaboration event with its own fighting game, Street Fighter 6."A demon begins his HUNT. Become the master of the fist with the Monster Hunter Wilds x Street Fighter 6 Special Collaboration!" Capcom teased in its announcement.The event goes live on May 28 and will introduce a brand new side mission called Ultimate Strength, which can be completed to recieve special collab rewards including a free Akuma full armor set and layered equipment based on the Street Fighter character.Equipping either set allows players to use Akuma's unique item and gestures to perform his fighting moves. Attack power of Akuma's unique actions is determined by the main weapon equipped.The full armor set boosts attack power more compared to the full layered armor set, Capcom explained in a post on its website, and Assisted Combos and other actions will gain stun properties, while the Drive Impact action will gain an offset effect.Completing accompanying event arena quests, Demonic Strength and True Strength, will also result in additional rewards like the 'Blanka-chan' Palico full armor set and layered equipment, and a Hunter Profile background, nameplate, and pose.Players must be Hunter Rank 21 or higher to take on the side mission, which can be initiated by talking to Quinn at the Oilwell Basin Base Camp.Capcom also notes this collaboration will be a permanent addition to the game, so there's no need to fear missing out.Additional paid downloadable content (DLC) inspired by Street Fighter 6 will also be available from May 28, including Chun-Li and Cammy outfits for Alma, a Blanka-Chan Doll pendant, a sticker set, and a gesture pack.In case you missed it, Capcom has released its roadmap for Monster Hunter Wilds, which reveals what updates we can expect for the rest of the year.You might also like...Best PS5 games 2025 - top PlayStation 5 titles to play right nowThe best multiplayer PC games 2025: our picks for the best titles to play with othersGhost of Yotei pre-orders live: Collector's Edition up in the US, Standard Edition retailers, and where to buy in the UK

Secretlab has revealed its Warhammer 40,000 Edition Magnus Pro Sit-to-Stand Metal Desk The desk features the Imperium of Man design from the game and offers magnetic cable anchors and sheaths for cable managementThe desk can be adjusted between 650mm and 1,250mm and features a custom backlit control panelSecretlab has announced the latest addition to its Warhammer 40,000 collection, the Magnus Pro Sit-to-Stand Metal Desk Warhammer 40,000 Edition.Designed in collaboration with Games Workshop, the Secretlab Magnus Pro Sit-to-Stand Metal Desk Warhammer 40,000 Edition follows Secretlab's release of the Titan Evo Warhammer 40,000 Ultramarines Edition chair that completes the ultimate PC and tabletop gaming setup fit for Warhammer fans.The officially licensed desk is designed to clear up space and manage cable clutter with the Secretlab Cable Management Bundle Warhammer 40,000 Edition magnetic cable anchors and sheaths to help maintain your workspace.Fans will recognize the map of the Imperium of Man design, which covers the entire desk, featuring Holy Terra and Mars at its center, detailed with black, gold, and red legends that indicate Imperial bastions and strongholds, major Imperial worlds, and Chaos-infested zones.It also pairs with the bundled Secretlab Magpad Desk Mat Warhammer 40,000 Edition, to "pay homage to the Throneworld of the Imperium".The sit-to-stand desk can be adjusted between 650mm and 1,250mm thanks to its precise controls. Alongside the map design, the desk also offers a custom backlit control panel on the edge of the desk for easy access.It also features the world’s first integrated power supply column, concealing a single cable within the desk leg, which leads to a power socket at the top.There is no release date just yet, but the Secretlab Magnus Pro Sit-to-Stand Metal Desk Warhammer 40,000 Edition (Bundle) will start at US$878 / CA$1,098 for the standard size (1.5m) and US$1,028 / CA$1,228 for the XL size (1.7m).You might also like...The best gaming desks in 2025: my picks for expanding and optimizing your setupWe've been testing the best gaming chairs for years and these are our top picks for work and playWarhammer 40,000: Space Marine 2 review: grim, glorious, and bloody brilliant

Even though it’s been almost a year since they released, I’ve still been going on and on about the Nothing Ear and Nothing Ear (a) as though they were the hot new gadgets in the block. But it’s time to stop dwelling on the past, even if one model does rank among the best wireless earbuds, and look to the future.Given that it’s been releasing new earbuds ever year, a regular ol' Santa Claus of music, it seems likely that tech company Nothing will be preparing a new pair of Nothing Ear buds for 2025 – especially given that company is now pairing with British hi-fi great KEF and has several audio products planned for release this year.The company’s been operating with an infuriating lack of a numbering system since the Ear (2), so I’m just going to call these the Nothing Ear (2025) for the purpose of making this article at least a little bit easy to read.At the time of writing, the only hints we have about a new set of Ear-branded buds and a budget companion are the hints about the KEF tie-up. So here's what I want to see in the new buds, in the absence of any concrete leaks about features. I’ve tested both of the 2024 models – as well as the Nothing Ear (open) – and will draw on that for this wish-list.Nothing Ear (2025): cut to the chaseWhat is it? The newest generation of Nothing earbudsWhen could it launch? Likely later in 2025How much could it cost? Standard for around $150 / £130 / AU$250, the cheaper (a) version for about a third less(Image credit: Future)Nothing Ear (2025): price and release date predictionsSo far, we've been looking at annual releases from Nothing; the Ear came out in April 2024 and the Ear (2) (which came before the Ear, despite the name) was released in March 2023.Nothing has said that's working on a pair of over-ear headphones for release likely later this year, but hasn't said anything about new earbuds specifically – only that it has multiple new audio products coming from its partnership with KEF.Based on the yearly cycle, I'd have expected to see the new earbuds already. It’s possible that the September 2024 release of the Nothing Ear (open) has caused the company to push its schedule by a few months, so let’s hope the new buds come in the middle few months of the year, or perhaps towards the end.And what about price? We’ve heard nothing on that front, but Nothing hasn’t done much to change the cost of its buds between generations. The Nothing Ear cost $149 / £129 / AU$249, while the Nothing Ear (a) went for $99 / £99 / AU$192.(Image credit: Future)Nothing Ear (2025): what we want to seeI reviewed the Nothing Ear for TechRadar and have been using the (a) for the best part of a year now as my 'standard' earbuds. So here's what I'd love to see on a new-and-improved version of the duo:1. A new Nothing Ear (a)If, like me, you think the Nothing Ear (a) remain some of the best earbuds you can buy right now, you might be alarmed to know that there are no guarantees a new version of this model will return.In fairness there’s no reason that a new Nothing Ear (a) won’t come out, but remember that 2024 was the first year we saw an (a)-style affordable alternative, following the company’s trend of (a) smartphones. So it’s not a recurring product type that’s guaranteed to return.I hope it does, though, because the Nothing Ear (a) have become the budget headphones I compare rivals too – and some updated ones in 2025 could wipe the floor clean with the competition.2. A longer battery lifeMy main gripe with the Nothing Ear in my review, which I also bump into when I’m using the Ear (a,) is that neither has a particularly impressive battery life.For context, you get about five hours of listening with the standard model and an extra half hour with the (a) – both figures while ANC is turned on. By my personal standards, anything sub-six-hour is sub-standard – I really like to see eight hours on the spec list.You might be wondering who listens to music for 8 hours straight – but I think you’d be surprised. That is, after all, the length of an average working day, and it’s the amount of time you might be wanting to listen if you’re travelling or working on something that requires audio.More than once the Ear (a) have run out of juice when I’ve needed them: once on a bus ride to my hometown, another time in the afternoon of a working day.So I’d love to see any of Nothing’s new earbuds offer a little more listening time before they run out of power.3. Improved cases(Image credit: Future)Both the Nothing Ear and Nothing Ear (a) came with cheap-feeling plasticky charging cases. I can excuse the (a)’s – the case is incredibly small, and the products are cheap themselves. But that’s not quite the case with the flagship device.The Nothing Ear’s case creaks a little in the hand, a true symptom of cheap plastic, and it doesn’t feel particularly premium to hold. It’s just a case, you’re not meant to get too riled-up about it, but Nothing’s decision to use see-through fronts in an attempt to evoke noughties-style gadget-nostalgia shows that case design is important to it.I’ve tested loads of much-cheaper earbuds that come with cases that feel more premium, usually due to the material or texture, for example the Sony WF-C510. Nothing should take notes.4. A slightly higher max volumeI know the whole point of active noise cancellation, or ANC, is to allow you to hear your music without you having to do so at a hearing-damagingly loud volume. But to get pumped, you sometimes need to play your tunes loud, and neither of the 2024 Nothing Ear products allowed for that.It’s not that I struggled to hear music (most of the time), just that the earbuds never let me turn the volume up to 11 – it’s also an issue I had with the the open-ear buds later in the year. Come on Nothing, let’s push that decibel count a little.5. The (a) having sound profile personalizationThey say beggars can’t be choosers, but I’m about to choose a premium feature I want to come to the affordable earbuds.One major difference between the Nothing Ear (a) and its premium sibling is that the latter had a sound personalization feature – it was an easy test that created a custom audio mix based on your unique sonic sensibilities. I tried it, and I loved it.Sure, a lack of features in the Nothing Ear (a) is the price you’re paying for… well, not paying a price. But it’s been a year – let’s let the budget buyers enjoy it now too. And maybe the higher-end model will have a new flagship feature to draw people to it.6. Funkier colors on the top-end model(Image credit: Future)I’ve been writing about tech for over six years now, and perhaps the most common complaint I’ve made about anything is how gadgets all too often come in only two boring color options: white or black. I want some color!Thankfully, the Nothing Ear (a) is one of the rare exceptions of funky-colored buds, coming in a yellow option that obviously I love to wear out. But if you don’t like yellow, you’re going to be left blue.I’d love to see a few more color options (colorways, as tech nerds call them) available in future generations. Admittedly Nothing is reticent to color products, judging by its phones, but it does offer its CMF-branded gadgets in a few more vibrant hues so perhaps it’s time to take inspiration from that budget range.7. Keep the equalizerThere’s no indication that Nothing is going to change the equalizer in its Nothing X app… but I can see why it’d want to.The Nothing X equalizer is pretty barebones by industry standards – many rivals offer eight- or 10-band equalizers, letting you tweak your sound profile down to the wire. However Nothing offers a three-band one so you can change bass, treble and mid, and that’s it.Many audiophiles will find this insufficient but I think that’s besides the point – a simple EQ like this is really easy to use for people who aren’t audiophiles, and it gives them a way to customize their music without having to sit through endless YouTube tutorials on what the various settings do. So I’d like to see Nothing keep this feature the same.You might also like…AirPods Pro 3: all the latest rumors and leaks, plus what we want to seeSkullcandy's won me over with the Bose-tuned Method 360 ANC, but one design choice baffles meSamsung's next pair of affordable Galaxy earbuds could come with a battery boost

It’s been a while since a company has thrown out a truly silly number of megapixels for a new phone. After all, the double-digit pixels found on most flagship handsets are just used to pixel bin the size down without harming the quality. Rejoice, then, when I tell you Honor’s new midrange 400 series is shipping with a 200 megapixel sensor working hand-in glove with an AI to make use of all that data. 200 megapixels, in this economy? Apparently so.

The 400 series is the latest in Honor’s not-at-all-confusingly-named “N” series of midrange handsets which bear numbers. Naturally, while there’s also a low end version of the 400 to buy, the company’s focus here (as always) was on the 400 Pro 5G and the regular 400 5G. Both models get that 200 megapixel primary camera tied to a Samsung-made 1/1.4-inch sensor with both optical and electronic image stabilization. Both are also equipped with a 12-megapixel macro/wide camera, plus a 50-megapixel front-facer.The Pro, however, also gets an additional 50-megapixel telephoto that the company claims will produce some impressive digital zoom.

Of course, these handsets are less about the raw numbers and more about what they can do when the images are run through the AI. Honor says the phones will capture and enhance portraits, erase passers-by, create videos from still images and can even remove reflective glare when taking pictures through panes of glass. Plus, on-device generative expand will expand the edge of an image if you feel the original was too closely cropped when you shot it. And Honor says the phone will use AI to create film simulation models to annoy all your Fuji-owning frenemies. Honor hasn’t yet been clear about how much of these AI innovations will be part of the phone and how much will require an extra subscription.

As for the rest of the phone, the 400 Pro’s spec list is no slouch: It’s got a Snapdragon 8, Gen 3 processor, 16GB RAM and a 5,300mAh silicon carbon battery. Up front, you’ll be staring into a 6.7-inch 2,800 x 1,280, 120Hz AMOLED display with a peak brightness of 5,000 nits. If you opt for the regular 400, then you’ll get a Snapdragon 7, Gen 3, 8GB RAM and a 6.55-inch, 120Hz AMOLED with a similarly beefy peak brightness. Both handsets will get Honor’s often-ballyhooed AI thread optimization for better sustained performance under load, such as if you’re gaming on the go. And the company has tweaked the graphics engine to better handle people’s massive photo libraries without stuttering.

The Honor 400 series is available to buy in Europe and the UK from today, with the Pro 5G setting you back €800 / £700. The regular 400 5G can be snapped up for €500 / £400 if you want 256GB storage and €550 / £450 if you want 512GB instead. Naturally, if you’re looking for a cheaper alternative, the “Lite” version can be picked up for €300, but the company didn’t share any specs for that particular handset. As usual, there's no word on if this handset will come to the US unless you import it yourself.

What Honor has been eager to point out, is the company has committed to providing six years of Android support for these handsets. That means buyers should expect to get at least that many OS and security updates, and Android 16 will be coming to the handsets by the end of the year.This article originally appeared on Engadget at https://www.engadget.com/mobile/smartphones/honors-midrange-400-series-pairs-a-200-megapixel-camera-with-the-usual-ai-tools-150018371.html?src=rss

The team behind GeoGuessr is withdrawing the location-guessing game from the Esports World Cup (EWC) after fans protested its decision to participate in the event. Community members pulled many popular custom maps from the game after it emerged the game's publisher, GeoGuessr AB, was going to hold a tournament at the EWC, which takes place in Riyadh, Saudi Arabia, in July.

Map creators who removed their community creations from GeoGuessr claimed that the EWC is "a sportswashing tool used by the government of Saudi Arabia to distract from and conceal its horrific human rights record." Many other prominent game franchises will be featured at the event, including Call of Duty, Overwatch, Rocket League, Street Fighter and EA Sports FC.

In a statement posted on X and Reddit, GeoGuessr AB CEO and co-founder Daniel Antell said the community stated loud and clear that the decision to take part in the EWC "does not align with what GeoGuessr stands for." As such, the team is pulling out of the event.

Here is Antell's full statement:

Hi everyone,I’ve seen your reactions over the past few days regarding our decision to participate in the Esports World Cup in Riyadh. When we made that decision, it was with positive intentions. To engage with our community in the Middle East and to spread GeoGuessr’s core mission of let everyone Explore the World.Since Erland, Anton, and I founded GeoGuessr in 2013, we’ve always strived to be a community-first game. Everyone here at the Stockholm office is a passionate GeoGuessr fan, doing our best to build something meaningful, with you and for you.That said, you - our community - have made it clear that this decision does not align with what GeoGuessr stands for.So, when you tell us we’ve got it wrong we take it seriously. That’s why we’ve made the decision to withdraw from participating in the Esports World Cup in Riyadh.We will come back with information on how the wildcards will be distributed as soon as possible.Thank you for speaking up and sharing your thoughts./DanielThis article originally appeared on Engadget at https://www.engadget.com/gaming/geoguessr-pulls-out-of-the-esports-world-cup-after-a-community-protest-151138984.html?src=rss

It might surprise you, but Memorial Day can be a great time to shop for tech. In years past, we've seen solid Memorial Day sales on all manner of gadgets including many of our favorite tablets, headphones, charging accessories, robot vacuums and more. That's on top of all the seasonal items that usually gets discounted at this time like smart grills and grilling gear, pizza ovens and outdoor tech.If you're on the market for any of those things, now's a good time to shop. And like most seasonal holidays as of late, you don't have to rush to make your purchase. Memorial Day sales are live now, and there's a good chance they'll be available until the holiday weekend has passed. Below, we've collected all of the best Memorial Day tech deals we could find for 2025, and we'll continue to update this post with the latest offers.We'd be remiss if we didn't mention Amazon Prime Day, though. The biggest iteration of the online retailer's annual shopping event typically happens in July, and Amazon confirmed it will be back again this year (although official dates remain unknown). Tech is usually heavily discounted on Prime Day for Prime members, so if you're unsure about a purchase, you could take the chance and wait a little while longer to see if that pair of earbuds you've been eyeing drops even further in price during Prime Day. If not, Memorial Day offers the next best opportunity this time of year to save on gadgets and gear.

Best Memorial Day tech sales: Top deals

Best Memorial Day tech deals

Peacock Premium (one year) for $25 ($55 off): The latest Peacock deal gives you one year of the Premium membership for only $25 when you use the code SPRINGSAVINGS at checkout. This ad-supported tier gives you access to some live sports content and more than 50 always-on channels, as well as the whole library of on-demand TV shows and movies Peacock has to offer. The deal runs through May 30.

ProtonVPN (two years) for $81 (66 percent off): ProtonVPN two-year plans are 66 percent off and down to only $81 right now. You'll save more than $150 on the total cost of the subscription with this deal, and in addition to VPN coverage for all your devices, you also get access to features that let you block ads, malware and other trackers.

Best Buy Memorial Day sale: Running through May 26, this sale includes big discounts on laptops, TVs, wearables, appliances and more. Standout deals include the Bose QuietComfort headphones for $229, a 75-inch LG 4K TV for $480 and the GoPro Hero 11 Mini for $130.

Ooni Memorial Day sale — 20 percent off almost everything: Most of Ooni's pizza ovens are on sale for Memorial Day, including the second-gen Karu 2, which is down to $319 from $399. The company's indoor electric pizza oven, the Volt 12, is also included in the sale: you can grab it for $629 instead of the usual $899.

Sonos Memorial Day sale —25 percent off portable speakers: You can save up to 25 percent on Sonos portable speakers right now, including the Move 2 and the Roam 2. The former is the more powerful of the two, with an IP56-rated design, Bluetooth and Wi-Fi connectivity and up to 24 hours of playback time. The Roam 2, on the other hand, will be easier to toss in your bag before heading to the beach, plus it has an IP67-rated design, Wi-Fi connectivity and 10 hours of playtime.

Anker On-the-Go sale — up to 50 percent off for members: It's free to sign up as an Anker member, and then you can get up to half off charging gear during this sale. For example, the Anker Prime 20K 200W power bank normally costs $130, but members can get it for $80 right now. Members will also get free gifts with some purchases, like a free 100W USB-C to C cable when you spend $79 or more.

PopSocket Memorial Day sale — up to 50 percent off: Through May 26, you can get half off some PopSocket grips, cases, wallets, mounts and more. There's a lot of variety in the styles on sale, so you'll likely be able to find something that fits your personal taste. Tons of MagSafe grips and cases are included, as well as MagSafe wallet accessories, too.

Apple AirTags (four-pack) for $75 (24 percent off): iPhone owners will appreciate how easy it is to keep track of things like wallets, keys, handbags and more with AirTags. These Bluetooth trackers monitor the location of your belongings so you can check in on them using the Find My app. Those with newer iPhones can also use UWB technology to get turn-by-turn directions to find their stuff when the AirTag is within close range.

Apple iPad (A16) for $299 ($50 off): This is the most affordable iPad that Apple makes, and it's probably sufficient for most people who primarily want an iPad to streaming shows and movies, browse the web, play some games and do other basic things. The latest model has a bumped-up 128GB of base storage and an excellent battery life.

Apple iPad Air (M3, 13-inch) for $699 ($100 off): This is the larger version of our top pick for the best iPad for most people. Recently updated with the M3 chipset, the latest iPad Air is extra speedy and powerful, plus it now has a better display than before and support for the Apple Pencil Pro. If you're looking for a big-screen iPad but don't want to pay top dollar, this is the most budget-friendly option available.

Apple Watch Series 10 for $299 ($100 off): The latest Apple Watch is the best smartwatch for most people thanks to its always-on OLED display, accurate and continuous activity tracking, solid workout tracking capabilities and handy features provided by watchOS 11.

MacBook Air (M4, 13-inch) for $899 ($100 off): Our top pick for the best laptop for most people, the latest MacBook Air has an impressively thin design and performance to match thanks to the M4 chipset. It also has excellent battery life and a comfortable keyboard-and-trackpad combo.

Apple Pencil Pro for $99 (23 percent off): If you have a new iPad Pro or iPad Air, this is the best Apple Pencil to get. It has a built-in gyroscope, supports squeeze gestures and pressure sensitivity and still magnetically attaches to the side of iPads for charging and safe keeping.

Samsung Galaxy S25 Ultra for $1,049 (19 percent off): Our top pick for the best premium Android phone, the S25 Ultra has everything a tech-lover would want in a smartphone. It has excellent performance and battery life, a stunning display, a slimmer overall design and a new 50MP ultra wide sensor in the rear camera array.

Samsung Type-C flash drive (512GB) for $50 (23 percent off): This high-capacity flash drive supports read speeds up to 400MB/s and works on a variety of devices including laptops and smartphones. In addition to having a five-year warranty, this flash drive is waterproof, shock-proof, magnet-proof, temperature-proof and X-ray-proof.

Samsung 24-inch Essential monitor S30GD for $100 (23 percent off): This 1080p IPS display has a 100Hz refresh rate and can be adjusted via tilting. Its design is pretty slim with thin bezels, and it connect to your computer via HDMI port.

Nori Press steam iron for $90 (25 percent off): This is essentially a flat iron for your clothes with six fabric settings to get the wrinkles out of your clothes. It was one of the things on our staff wishlist during the 2024 holiday season, and it would make a great gift for apartment dwellers who don't have the space for a full ironing board, or those who travel often and need their clothes to look fresh.

Thermacell E-Series rechargeable mosquito repeller for $32 (20 percent off): Thermacell devices have long been some of our favorite outdoor gear, and the E-series is compact but powerful. It'll keep mosquitos away within its 20-foot range and now it comes with a fast-charging dock.

ThermoWorks ThermaPen One for $76 (30 percent off): We've long been fans of the ThermaPen One, so much so that it's reserved a spot on our best grilling gear list for a number of years. It provides accurate food temperature readings within a second or so, and its display is now brighter than the previous model. The screen will also auto-rotate depending on how you're holding the ThermaPen, so it'll be easier to read.

ThermoWorks RFX starter kit (four-probe) for $349 ($86 off): ThermoWorks' new smart grill probe is accurate and reliable, and the starter kit includes everything you need to get grilling immediately. We gave it a score of 92 in our review and declared that "the company simply does not miss."

Anker Soundcore Space A40 earbuds for $45 ($35 off): Our top pick for the best budget wireless earbuds, the Space A40 punch above their weight in almost every way. They have excellent ANC, a good sound profile overall, a comfortable fit, multi-device connectivity and wireless charging support.

Dyson V8 Plus cordless vacuum for $350 (26 percent off): The V8 is a great entry-level Dyson that boasts 40 minutes of runtime, two power modes, a motorbar cleaner head that works on all kinds of flooring and four additional cleaning attachments. Also available at Dyson in the Absolute model.

Amazon Fire TV Stick HD for $20 (43 percent off): The top budget pick in our best streaming devices guide, this latest model of the Fire TV Stick HD is an easy way to update an aging TV with streaming smarts. It supports HD video and all major streaming services, plus the updated remote can now control your TV's power and volume.

Ring Battery Doorbell for $55 (45 percent off): This 2024 battery-powered Ring video doorbell records 1440p video, sends motion alerts to your phone and supports two-way talk, live view and quick replies. It powers up via USB-C, and it can be installed with or without hardwiring it to your existing doorbell setup.

Blink Outdoor 4 security cameras, 5 camera system for $200 (50 percent off): This pack-up includes give weather-resistant Blink Outdoor 4 cameras plus a Sync Module 2 to connect them all. These are some of our favorite security cameras thanks to their wireless design, accurate and speedy motion alerts and the ability to save footage locally when you use a thumb drive with the Sync Module 2.

Lenovo ThinkVision 23.8-inch Monitor T24i-30 for $183 (46 percent off): This FHD IPS panel has a three-side, NearEdgeless bezel design and can be adjusted via tilt, lift, swivel and pivot. In addition to four USB-A ports for connecting peripherals, it also supports a number of display connections including HDMI, DP and VGA.

iRobot Combo Essential robot vacuum for $150 ($125 off): This is a great entry-level robot vacuum that has the added convenience of being a mopping machine, too. It'll suck up dirt, debris and pet hair while it vacuums, and you can use the included water reservoir when you want to mop hard floors.

Shark PowerDetect NeverTouch Robot Vacuum and Mop for $700 (30 percent off): A version of one of our favorite robot vacuums, this Shark machine can vacuum and mop floors for you. Its self-emptying base station holds up to 30 days worth of debris, and it has a refill tank for the mopping reservoir as well.

Levoit LVAC-200 cordless vacuum cleaner for $150 (25 percent off): A top budget pick in our best cordless vacuums guide, this Levoit machine has a single-button start, tackles debris and pet hair with ease and it has a lightweight design that can be easily disassembled for convenient storage.

Tineco Pure ONE S11 Cordless Vacuum Cleaner for $140 ($60 off with coupon): Our top budget pick among the best cordless vacuums, this Tineco machine offers good suction and a relatively lightweight design at a great price. It also includes the company's iLoop smart sensor, which will auto-adjust suction power as you clean.

Expired deals

Withings Thermo smart thermometer for $86 ($14 off): This FDA cleared, FSA/HSA/HRA eligible thermometer can take no-contact temperature readings in just a few seconds with a simple swipe across the forehead. It uses 16 infrared sensors to take over 4,000 measurements for the most accurate readings, and the built-in LED screen will show you color-coded results.

Ninja Artisan 5-in-1 outdoor electric pizza oven for $230 (23 percent off): This model from Ninja can create 12-inch pies in as little as three minutes, and it also has other cooking modes like bake, proof, broil and warm. You can choose from five unique pizza settings (Neapolitan, Thin Crust, Pan, New York, and Custom) and you can take control of cooking by adjusting the temperature from 90 to 700 degrees Fahrenheit. Also available at Amazon.

Beats Studio Pro for $170 (51 percent off): The latest version of the Beats Studio Pro have much-improved sound quality along with good voice performance and Transparency mode. While these are wireless headphones, you can also connect a USB-C cable to them to use them as wired headphones, too.

Beats Powerbeats Pro 2 for $200 (20 percent off): The new Powerbeats Pro 2 have a comfortable design, improved sound quality and bass performance and heart rate sensors on board that make them good workout companions. However, you'll only be able to get that heart rate data if you have these buds paired to an iOS device.

Shark Clean & Empty Cordless Stick Vacuum for $280 (20 percent off): This is a slightly cheaper version of one of our favorite cordless stick vacuums and it comes with a self-emptying base. This Shark stick vacuum has good suction power, can easily convert to a hand vacuum and it docks neatly on its auto-empty base station that traps over 99 percent of dust and allergens.

EcoFlow Delta 2 Max 2048Wh power station for $999 (41 percent off): This is a higher-capacity version of the Delta 2, so it'll last longer and power gadgets and appliances for a longer period of time on a full charge. It also has 15 connectors and you can optionally add on solar panels for easy powering-up on the go.

EcoFlow Delta 2 1024Wh power station with waterproof bag for $479 (31 percent off): This EcoFlow power station provides 15 connectors to power up multiple devices at once — those include six AC outlets, two USB-C ports and four USB-A ports. It's versatile enough to take it camping or on a road trip, but it can also act as a home backup battery, powering a refrigerator, lights, CPAP machines and more.

Dyson Supersonic hair dryer for $330 ($100 off): This is the original Dyson Supersonic hair dryer that has been super popular since its debut. It includes five attachments for drying and styling, and it's billed as a fast dryer that protects hair from heat damage.

Follow @EngadgetDeals on X for the latest tech deals and buying advice.This article originally appeared on Engadget at https://www.engadget.com/deals/best-memorial-day-tech-sales-from-amazon-apple-samsung-and-others-that-you-can-shop-now-144526995.html?src=rss

Coinbase filed a new form with the Maine Attorney GeneralIt confirmed when the attack happened and how many people were affectedThe company confirmed offering a bounty We now know exactly how many people are affected by the recent Coinbase data breach - 69,461. The company confirmed the news in a new filing with the Office of the Maine Attorney General. In the filing, the company said that the attack took place in late December, 2024, and that it was spotted months later, in mid-May 2025.It also shared a data breach notification letter it is sending out to affected people, in which it detailed what happened.Apparently, threat actors bribed “a small number of individuals performing services for Coinbase” to have them exfiltrate sensitive customer data.Save up to 68% on identity theft protection for Techradar readersTechRadar editors praise Aura's upfront pricing and simplicity. Aura also includes a password manager, VPN, and antivirus to make its security solution an even more compelling deal.Preferred partner (What does this mean?)View DealExtortions and bountiesThese individuals, which were allegedly fired afterwards, stole identity information (names, dates of birth, last four digits of their social security numbers), masked bank account numbers and “some bank account identifiers”, addresses, phone numbers, email addresses, images of IDs, driver’s licenses, and passports, and different account information (transaction history, balance, transfers, and more).The attackers then tried to extort Coinbase for $20 million, in exchange for deleting the data. Coinbase not only denied the offer, but also doubled-down on it, offering the exact same sum - $20 million, to whoever comes forward with actionable information about the identities or whereabouts of the attackers.Earlier reports on Reuters claimed the attack might cost Coinbase between $180 million and $400 million, citing a regulatory filing the company submitted recently.Besides offering a $20 million bounty, Coinbase also promised to “make customers whole” - by reimbursing anyone who can prove that they lost money after a social engineering attack made possible by the data stolen from the crypto exchange.Coinbase also said it was working with law enforcement, and urged users to stay vigilant, create strong passwords, set up multi-factor authentication (MFA), and never share their login credentials with anyone.Via TechCrunchYou might also likePersonal information leaked in Coinbase cyberattack, cost could be $400 millionTake a look at our guide to the best authenticator appWe've rounded up the best password managers

Amazon is testing a new feature that involves AI-generated hosts talking through product summaries. It looks fairly similar to Google’s audio overviews, which also include AI-generated hosts that seem plucked from a middling podcast.

Amazon says that these "AI shopping experts help save time by compiling research and providing product highlights for customers from product pages, reviews and insights." This leads me to an obvious question. Amazon is notorious for hosting fake reviews. Some studies suggest that fake reviews account for more than 40 percent of the sum total. Do these AI hosts pull from those reviews? We've reached out to Amazon and will update this post if we hear back.

Each audio summary will remind you that it was generated by AI, just before an introduction from the "expert" hosts. Amazon says these hosts are "like having helpful friends discuss potential purchases to make your shopping easier."

You might be able to try this out right now. It's currently available to some US customers on the mobile app for certain products, like this Ninja Blender, OSEA Undaria Algae Body Oil, SHOKZ OpenRun Pro headphones and a couple of other items. Just tap the "Hear the highlights" button under the product. Amazon has stated it'll be rolling this out to more customers and more products in the near future.

I can see this being a boon for those with visual impairment issues, but I listened to a couple of summaries and they certainly don't save any time. I could peruse reviews, look at product information and even conduct a web search of my own in a fraction of the time it took the friendly experts to complete their spiel.

The company says this feature is useful when "multitasking or on the go" but I don't tend to mindlessly spend money in that way. Do you? This seems like another AI thingamabob that nobody really asked for, but maybe it'll find a niche somewhere. Again, this could be seriously useful for the visually impaired, but that's not how Amazon is pitching it.This article originally appeared on Engadget at https://www.engadget.com/ai/amazon-is-testing-ai-generated-hosts-that-talk-customers-through-product-features-153112886.html?src=rss

Disney has taken another step into the hyper-competitive world of live sports broadcasting. According to The Guardian, the entertainment conglomerate has secured a five-year deal to broadcast live Women’s Champions League soccer matches on Disney+ across multiple European broadcast territories, including the United Kingdom.

From the NFL on YouTube to the Grammys on Disney+, the broadcast rights to live events have become a hot commodity as streamers look to make inroads into one of cable TV’s biggest selling points. And in recent years, broadcast rights for women’s sports leagues have become more competitive as the category’s growth in viewership accelerates.

Amazon has been streaming WNBA games since 2021, and last year Netflix secured the rights to broadcast the FIFA Women’s World Cup. Disney’s investment in streaming the best in European women’s soccer signals an important continuation of that trend.

According to the same report by The Guardian, Disney made a “hugely competitive offer” for the streaming rights, and is said to be investing not only in the rights themselves, but in extensive coverage with high-caliber production. The deal was entered into in agreement with UC3, the joint venture between UEFA and the European Club Association, which means club representatives were involved in the discussions.

In the United States, the broadcast rights for the Women’s Champions League are held exclusively by DAZN; the platform currently streams 19 matches for free in addition to more for subscribers. YouTube had signed on as a streaming partner in the US for all games from 2021 to 2023, but didn’t renew that deal when it ended.

The deal reportedly includes some free-to-air coverage of the Women’s Champions League in the United Kingdom, though there are no details yet on which games or how many exactly. So if you’re in the UK, don’t forget to renew that TV license.This article originally appeared on Engadget at https://www.engadget.com/entertainment/streaming/disney-will-reportedly-stream-womens-champions-league-soccer-matches-across-much-of-europe-155854592.html?src=rss