News

Tiny magnetic transmitter weighs just 7.9gCompatible with Insta360 X5, Ace Pro 2, Flow series and moreInsta360 Mic Air price starts at just $49.99 / £49.99 / AU$89.99There’s no shortage of tiny digital mics designed for content creators on the market, and Insta360 has just entered the fray with its first ever wireless mic: the Insta360 Mic Air.The Mic Air transmitter (or TX) is a coin-sized disc that can be clipped to a collar, fixed to a shirt with a magnetic clamp or even worn like a pendant. It comes supplied with a windshield to help cut down unwanted exterior noise, plus built-in noise reduction technology. It offers 10-hour battery life and a 300m wireless range.Here's what really neat – the Mic Air supports 48kHz/24-bit audio via a direct wireless connection with two of Insta360’s action cameras: the Insta360 X5 and Insta360 Ace Pro 2. A direct wireless connection between transmitter does away with the need for a receiver (RX), and it something that DJI's Mic Mini can do with DJI products.If you mix brands, you lose that direct wireless connectivity, and would need a receiver instead. As such, it makes practical sense to brand match your action and wireless mic, so if you're an X5 user, the new Mic Air makes the most sense. Further Mic Air-compatible models will follow soon, according to Insta360.The Mic Air can also be purchased in an RX (receiver) and TX (transmitter) bundle. The RX unit can be connected to smartphones, Insta360’s Flow gimbals and other devices, expanding the range of compatible hardware.The Mic Air TX is compatible with the Insta360 X5 360 camera. (Image credit: Insta360)Already available to orderDesigned to compete with the likes of the DJI Mic Mini, Rode Wireless Micro and Boya Mini, the Insta360 Mic Air is compact, lightweight (the TX transmitter being just 7.9g) and affordable: it’s available now at Amazon US and Amazon UK, priced at just $49.99 / £49.99 / AU$89.99 for a single TX, and $69.99 / £69.99 / AU$116.99 for the RX and TX bundle, and for the same price at the Insta360 store.That’s roughly the same as the equivalent DJI Mic Mini bundles, although interestingly Insta360 has decided against selling a more complete package, such as two TX units, one RX and a charging case bundle – at least for now. These all-in-one packages, such as you can buy DJI's Mic Mini, offer a lot more battery life thanks to the charging case, plus a second TX for two-person audio capture. Seemingly these are two areas where Insta360 is clearly happy to concede the floor to rivals like DJI and Rode.The RX unit (on the right) expands compatibility to smartphones and other devices. (Image credit: Insta360)While the Mic Air is a pretty straightforward and even obvious addition to the Insta360 product line-up, it’s also a sign that the company’s ambitions seem to be growing. Just as DJI was once known mainly for its drones, but now also makes action cameras, gimbals, microphones, portable power stations, electric bikes and even, apparently, a robot vacuum cleaner, Insta360 is gradually increasing and diversifying its line-up.It also means that Insta360 X5 (and Ace Pro 2) users looking for a wireless mic to level up their audio can stay on brand, rather than pairing the 360 camera with a mic from a rival brand, such as DJI, which feels like an obvious move on Insta360's part. In fact, the mic will be available with the X5 in an Ultimate Creator Bundle, for $669 / £669 (Australia price TBC).A review sample of the Mic Air is on its way to us from Insta360, so look out for a full, in-depth review soon. We’re keen to see how it lines up against the DJI Mic Mini, which is widely regarded as the current market leader for ultra-compact affordable mics.You might also like...The DJI Mic Mini is superb, but there's one big reason I'd pick the Rode Wireless Micro for smartphone content creation insteadLeaked Osmo Nano images suggest DJI is taking a second swing at tiny modular action camsCamera rumors for 2025: new gear we're expecting soon from DJI, Sony, Canon and more

The limited-edition, Xbox-branded Meta Quest 3S headset has arrived. Reports over the weekend suggested that this model, which Meta announced a little over a year ago, would become available on June 24 and that turned out to be the case.

This version of the headset comes in Xbox's classic black aesthetic with a green trim, and a matching Xbox Wireless Controller and Touch Plus controllers. You'll be able to connect other controllers to the headset, including the Xbox Wireless Controller, Xbox Elite Wireless Controller Series 2 and Xbox Adaptive Controller, as well as third-party gamepads like the Backbone Pro.

The Meta Quest 3S Xbox Edition has 128GB of storage and comes with an Elite Strap, as well as three months of access to both Meta Horizon+ and Xbox Game Pass Ultimate. With the latter, you can play games via the cloud on the Xbox app, including supported games you own that are not part of the Game Pass Ultimate catalog.

At $400, this bundle costs a bit more than the standard $300 Meta Quest 3S. Microsoft says that the Meta Quest 3S Xbox Edition is available now, but "quantities are extremely limited." If you'd like to pick one up, you can do so from Meta's website, Best Buy in the US and Argos and EE in the UK. It's only available in those two countries.

The Xbox app with cloud gaming support has been available on Quest headsets since late 2023. Still, this partnership aligns with Microsoft's push to have Xbox games accessible on as many devices as possible. The company recently announced Xbox-branded ASUS ROG Ally handheld gaming PCs that will be available later this year, and it has hinted at a more open future for the Xbox platform.

This article originally appeared on Engadget at https://www.engadget.com/gaming/xbox/the-meta-quest-3s-xbox-edition-is-out-now-and-it-costs-400-134358869.html?src=rss

Over the last year, threat actors have upped the ante with their plots to disrupt vital business and public services – and they have had increasingly successful outcomes. In fact, the UK government estimates that some of the most disruptive breaches cost businesses, of any size, an average of approximately £1,205. When looking at medium and large enterprises, this cost increases to approximately £10,830.The UK government recognizes the increasing dependence of businesses and organizations on digital technologies, which are vulnerable to constantly evolving cyberattacks. To address this, it is investing £2.6 billion in the National Cyber Strategy to enhance and protect the UK’s online presence.Central to this effort is promoting ‘cyber resilience’ – organizations' ability to prepare for, respond to and recover from cyberattacks and security breaches. This resilience is fundamental to operational continuity, business growth and the overall health of the UK economy.Evolving attack techniques signal an increased threat to businessesConsidering there were almost 9 million DDoS attacks globally in the second half of 2024, per NETSCOUT’s latest Threat Intelligence Report, the government’s greater focus on building cyber resilience is much needed. While the number of DDoS attacks across 2H2024 increased by more than 12 percent from the first half of the year, attacks are also more sophisticated than ever before.For instance, application programming interfaces (APIs) paired with automation allows threat actors to carry out multitarget DDoS campaigns with minimal supervision, significantly increasing their attack efficiency.Additionally, advanced techniques such as carpet-bombing, IPv6 abuse, internet service provider (ISP) masking and geo-spoofing expand attack reach for threat actors, allowing them to target victims regardless of their location, and bypass defenses.The combination of increased frequency and sophistication of attacks increases the risk to businesses of being attacked. As has been seen from countless highly publicized incidents – such as the sophisticated cyberattack on Transport for London that disrupted services across the city in September – the devastation caused by DDoS attacks is significant.When websites and business-critical applications are taken offline, the results are lost revenue, unhappy customers and irreparable damage to an organization's brand. The threat is continuing to grow so it is more important than ever for ISPs and enterprises to fully protect their networks and other critical infrastructure. To achieve this, organizations must look for more efficient and effective DDoS defense systems.Exploring threat actors’ changing motivationsAt a global level, there has been a noticeable increase in sophisticated DDoS hacktivism. Hacktivist groups have showcased their advanced technical capabilities, launching politically motivated cyberattacks against governments, infrastructure, and organizations around the world.For example, NoName057(16) is the dominant actor behind geopolitical DDoS campaigns, focusing its efforts on government websites in the UK, Belgium, and Spain. In the last few years, this activity has signaled the beginning of a new era of cyber threats.Geopolitical events drove massive attack spikes in 2024, with DDoS attacks increasingly becoming a weapon for political unrest. Threat actors have exploited periods of national vulnerability to amplify chaos and undermine confidence in institutions. For instance, Israel experienced a 2,844 percent surge in February tied to the conflict in Gaza, and Georgia saw a 1,489 percent increase in April leading up to the “Russia bill”.These examples highlight the extent to which DDoS has become a go-to tool in sociopolitical conflicts – being deployed during elections, protests, and policy disputes – and how public sector and enterprise defenses need a rethink. Since attackers use a variety of techniques, ranging from custom-built tools to surprisingly simple methods, the need for robust and adaptable security measures is greater than ever.Defending against DDoS attacksThe threat posed by DDoS attacks is a serious concern for businesses. Despite the prevalence of these attacks, the dangers often go unnoticed, with malicious traffic frequently mistaken for legitimate activity. Clever hackers can leave organizations vulnerable, even if they believe their defenses are robust.To mitigate DDoS attacks, organizations should focus on reducing or terminating harmful traffic as soon as it is detected. Increasing network capacity is also crucial, as it helps absorb malicious traffic and prevents systems from being overwhelmed. Additionally, completely blocking anonymous and remote systems can make targets inaccessible to attackers, adding an extra layer of protection.By implementing these strategies, organizations can enhance their visibility and resilience against DDoS attacks, navigating the complex landscape of cybersecurity with greater confidence.Staying ahead of emerging cyber threatsThe importance of keeping up with cyber threats cannot be overstated. Businesses should have a powerful DDoS protection system in place and regularly assess their network infrastructure. Just as organizations regularly prepare for fire drills by testing their alarms, proactively reassessing and regularly enhancing security measures is essential to stay afloat in the ever-evolving cyber threat landscape. With the shifting nature of DDoS threats, it is imperative for businesses to stay ahead of the curve, or they risk the severe consequences that come with being the victim of a DDoS attack.After all, the devastating impact of cyberattacks across sectors has been seen globally with too many instances to count. Therefore, organizations need to be aware of current threat trends and prioritize their defense strategies. With comprehensive visibility, actionable threat intelligence and the right security team in place, businesses can build the awareness and resilience needed to navigate today’s threat landscape effectively.We've featured the best online cybersecurity course.This article was produced as part of TechRadarPro's Expert Insights channel where we feature the best and brightest minds in the technology industry today. The views expressed here are those of the author and are not necessarily those of TechRadarPro or Future plc. If you are interested in contributing find out more here: https://www.techradar.com/news/submit-your-story-to-techradar-pro

Looking for a different day?A new NYT Connections puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Tuesday's puzzle instead then click here: NYT Connections hints and answers for Tuesday, June 24 (game #744).Good morning! Let's play Connections, the NYT's clever word game that challenges you to group answers in various categories. It can be tough, so read on if you need Connections hints.What should you do once you've finished? Why, play some more word games of course. I've also got daily Strands hints and answers and Quordle hints and answers articles if you need help for those too, while Marc's Wordle today page covers the original viral word game.SPOILER WARNING: Information about NYT Connections today is below, so don't read on if you don't want to know the answers.NYT Connections today (game #745) - today's words(Image credit: New York Times)Today's NYT Connections words are…CRANCUPRASPRAVESTRAWGOATHEROBLUEPLANELIDJACKSAWFLAMINGNAPKINCHISELSWISSNYT Connections today (game #745) - hint #1 - group hintsWhat are some clues for today's NYT Connections groups?YELLOW: Dairy slicesGREEN: Found at the coffee shopBLUE: Essential for carpentryPURPLE: Flying but something’s missingNeed more clues?We're firmly in spoiler territory now, but read on if you want to know what the four theme answers are for today's NYT Connections puzzles…NYT Connections today (game #745) - hint #2 - group answersWhat are the answers for today's NYT Connections groups?YELLOW: KINDS OF CHEESES GREEN: BEVERAGE SELF-SERVICE ITEMS BLUE: WOODWORKING HAND TOOLS PURPLE: BIRDS MINUS LAST LETTER Right, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Connections today (game #745) - the answers(Image credit: New York Times)The answers to today's Connections, game #745, are…YELLOW: KINDS OF CHEESES BLUE, GOAT, JACK, SWISSGREEN: BEVERAGE SELF-SERVICE ITEMS CUP, LID, NAPKIN, STRAWBLUE: WOODWORKING HAND TOOLS CHISEL, PLANE, RASP, SAWPURPLE: BIRDS MINUS LAST LETTER CRAN, FLAMING, HERO, RAVEMy rating: HardMy score: 1 mistakeI fell hook, line, and sinker for today’s trap.Uncertain what CRAN could possibly refer to, I had one of those moments of realization that only Connections can give you, when the clouds of confusion part and suddenly everything becomes clear.“Cran”, I thought must be short for cranberry and ah yes, there is STRAW short for strawberry, BLUE for blueberry, and RASP for raspberry. Then came the other classic Connections sensation, when after thinking you are really clever and have found four linked words you discover you are wrong. So wrong in fact that you are looking for a “group of four”.Pulling myself back together I managed to muddle through – not that I ever had any inkling that cran could be part of a group of BIRDS MINUS LAST LETTER.How did you do today? Let me know in the comments below.Yesterday's NYT Connections answers (Tuesday, June 24, game #744)YELLOW: STRICT FIRM, RIGID, STERN, TOUGHGREEN: BOTANICAL COVERINGS HULL, HUSK, POD, SHELLBLUE: SEEN IN OPENING CREDITS CAST, DIRECTOR, STUDIO, TITLEPURPLE: OBJECTS IN 0-, 1-, 2- AND 3-DIMENSIONAL SPACE LINE, PLANE, POINT, SOLIDWhat is NYT Connections?NYT Connections is one of several increasingly popular word games made by the New York Times. It challenges you to find groups of four items that share something in common, and each group has a different difficulty level: green is easy, yellow a little harder, blue often quite tough and purple usually very difficult.On the plus side, you don't technically need to solve the final one, as you'll be able to answer that one by a process of elimination. What's more, you can make up to four mistakes, which gives you a little bit of breathing room.It's a little more involved than something like Wordle, however, and there are plenty of opportunities for the game to trip you up with tricks. For instance, watch out for homophones and other word games that could disguise the answers.It's playable for free via the NYT Games site on desktop or mobile.

Looking for a different day?A new NYT Strands puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Tuesday's puzzle instead then click here: NYT Strands hints and answers for Tuesday, June 24 (game #478).Strands is the NYT's latest word game after the likes of Wordle, Spelling Bee and Connections – and it's great fun. It can be difficult, though, so read on for my Strands hints.Want more word-based fun? Then check out my NYT Connections today and Quordle today pages for hints and answers for those games, and Marc's Wordle today page for the original viral word game.SPOILER WARNING: Information about NYT Strands today is below, so don't read on if you don't want to know the answers.NYT Strands today (game #479) - hint #1 - today's themeWhat is the theme of today's NYT Strands?• Today's NYT Strands theme is… Worth the splurgeNYT Strands today (game #479) - hint #2 - clue wordsPlay any of these words to unlock the in-game hints system.DOOMSCONEMENUBENDFURYTILENYT Strands today (game #479) - hint #3 - spangram lettersHow many letters are in today's spangram?• Spangram has 11 lettersNYT Strands today (game #479) - hint #4 - spangram positionWhat are two sides of the board that today's spangram touches?First side: top, 4th columnLast side: left, 7th rowRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.NYT Strands today (game #479) - the answers(Image credit: New York Times)The answers to today's Strands, game #479, are…WATCHHANDBAGJEWELRYPERFUMECONVERTIBLESPANGRAM: LUXURY GOODSMy rating: EasyMy score: PerfectNot much of a stretch today, with all the words hiding in plain sight with minimal twists. The biggest surprise was the very rare sight of a spangram that started at the top and ended at the side.“Worth the splurge” immediately had me thinking about family vacations, which are nearly always spending your hard earned cash on. Instead, after finding WATCH and HANDBAG it became obvious we were looking for the standard array of LUXURY GOODS.The thing all the items we were searching for today have in common is that they are all non essential and that cheaper versions of all of them are readily available, although with the exception of PERFUME all can be justified as splurge-worthy as they do not depreciate at the same rate as those cheaper versions (that’s what we tell ourselves anyway).How did you do today? Let me know in the comments below.Yesterday's NYT Strands answers (Tuesday, June 24, game #478)FLAXSEEDPROBIOTICCALCIUMZINCMAGNESIUMSPANGRAM: SUPPLEMENTSWhat is NYT Strands?Strands is the NYT's not-so-new-any-more word game, following Wordle and Connections. It's now a fully fledged member of the NYT's games stable that has been running for a year and which can be played on the NYT Games site on desktop or mobile.I've got a full guide to how to play NYT Strands, complete with tips for solving it, so check that out if you're struggling to beat it each day.

Looking for a different day?A new Quordle puzzle appears at midnight each day for your time zone – which means that some people are always playing 'today's game' while others are playing 'yesterday's'. If you're looking for Tuesday's puzzle instead then click here: Quordle hints and answers for Tuesday, June 24 (game #1247).Quordle was one of the original Wordle alternatives and is still going strong now more than 1,100 games later. It offers a genuine challenge, though, so read on if you need some Quordle hints today – or scroll down further for the answers.Enjoy playing word games? You can also check out my NYT Connections today and NYT Strands today pages for hints and answers for those puzzles, while Marc's Wordle today column covers the original viral word game.SPOILER WARNING: Information about Quordle today is below, so don't read on if you don't want to know the answers.Quordle today (game #1248) - hint #1 - VowelsHow many different vowels are in Quordle today?• The number of different vowels in Quordle today is 4*.* Note that by vowel we mean the five standard vowels (A, E, I, O, U), not Y (which is sometimes counted as a vowel too). Quordle today (game #1248) - hint #2 - repeated lettersDo any of today's Quordle answers contain repeated letters?• The number of Quordle answers containing a repeated letter today is 2.Quordle today (game #1248) - hint #3 - uncommon lettersDo the letters Q, Z, X or J appear in Quordle today?• Yes. One of Q, Z, X or J appears among today's Quordle answers.Quordle today (game #1248) - hint #4 - starting letters (1)Do any of today's Quordle puzzles start with the same letter?• The number of today's Quordle answers starting with the same letter is 2.If you just want to know the answers at this stage, simply scroll down. If you're not ready yet then here's one more clue to make things a lot easier:Quordle today (game #1248) - hint #5 - starting letters (2)What letters do today's Quordle answers start with?• S• C• M• SRight, the answers are below, so DO NOT SCROLL ANY FURTHER IF YOU DON'T WANT TO SEE THEM.Quordle today (game #1248) - the answers(Image credit: Merriam-Webster)The answers to today's Quordle, game #1248, are…SOGGYCLASHMODEMSQUADI got caught out by MODEM guessing the more obvious word with model, but I still found today’s Quordle immensely satisfying to complete.Perhaps it was the rare appearance of the letter Q, or maybe CLASH reminding me of one of my favorite bands, or possibly it’s just because the sun is shining here in London and I can go out for a walk without getting SOGGY.How did you do today? Let me know in the comments below.Daily Sequence today (game #1248) - the answers(Image credit: Merriam-Webster)The answers to today's Quordle Daily Sequence, game #1248, are…CRIEDSTEADKAPPACLUCKQuordle answers: The past 20Quordle #1247, Tuesday, 24 June: QUALM, SQUIB, AXIAL, FLACKQuordle #1246, Monday, 23 June: PIXEL, FJORD, STEAL, EXISTQuordle #1245, Sunday, 22 June: WREST, CRAZE, PAPAL, SCIONQuordle #1244, Saturday, 21 June: BUDDY, GROUT, BEGIN, MADAMQuordle #1243, Friday, 20 June: BRAID, DULLY, HASTE, LURIDQuordle #1242, Thursday, 19 June: BRUSH, ISLET, FRUIT, PRIVYQuordle #1241, Wednesday, 18 June: MEDIA, SHARK, GUPPY, MOURNQuordle #1240, Tuesday, 17 June: LEAPT, PRISM, ADMIN, WHINEQuordle #1239, Monday, 16 June: RETRY, SCALD, DINGO, FEIGNQuordle #1238, Sunday, 15 June: SHOCK, STEIN, BROIL, COVENQuordle #1237, Saturday, 14 June: STICK, FERRY, THESE, IONICQuordle #1236, Friday, 13 June: REPEL, LARGE, SNIDE, CARRYQuordle #1235, Thursday, 12 June: SCANT, BATCH, UNDER, PARSEQuordle #1234, Wednesday, 11 June: CRAVE, ROOST, ANGLE, FLOODQuordle #1233, Tuesday, 10 June: DECRY, CHEEK, FILET, EASELQuordle #1232, Monday, 9 June: DERBY, LEMON, WRITE, HOVELQuordle #1231, Sunday, 8 June: REBAR, ALERT, PAYEE, FLUMEQuordle #1230, Saturday, 7 June: FLUNK, ESTER, SPITE, CHEAPQuordle #1229, Friday, 6 June: ELUDE, KHAKI, VISTA, SMOKYQuordle #1228, Thursday, 5 June: CHIDE, RABBI, GUSTY, LANCE

Amazon Prime Day deals are already popping up online, and one of the best ones we've found so far is on a teeny, tiny 8BitDo controller. The 8BitDo Micro Bluetooth gamepad is on sale for only $15 right now, which is $10 off its usual price and a record low. It comes in green and blue, but the discount only applies to the former.

While designed for the Nintendo Switch and Android devices, the Micro should also work well with devices like iPhones and even in the Steam Deck. The company also released a firmware update for Switch 2 compatibility, so that should work too.

This is an extremely tiny gamepad that still manages to pack in 16 buttons. It's a near-perfect way to play retro-tinged 2D platformers. Did we mention it's small? This thing will easily fit in a pocket or just about anywhere else. The company wasn't kidding around when they named it Micro.

There's one caveat. The diminutive size of the 8BitDo Micro doesn't allow for actual joysticks and there's no haptic engine for rumble or anything like that. This isn't the best controller for brand-new AAA games, so just keep that in mind.This article originally appeared on Engadget at https://www.engadget.com/deals/the-8bitdo-micro-bluetooth-gamepad-drops-to-15-ahead-of-prime-day-151924531.html?src=rss

McLaren Health Care and Karmanos Caner Institute patients are being warned of 2024 breachSuspicious activity was caught in August 2024A nine-month review has concludedA ransomware attack between July and August 2024 affecting McLaren Health Care and Karmanos Cancer Institute has resulted in a mammoth data breach affecting nearly 750,000 people.Hackers stole the data of 743,131 people, including their Social Security numbers, health insurance information, driver's license details, names and medical data.The attack has been linked to the INC ransomware gang, however McLaren's public statement failed to directly attribute the attack to any group.Nearly 750,000 patients have data stolenAttackers were first believed to have breached the systems on July 17, 2024, with suspicious activity later detected on August 5, 2024. Nine months later, on May 5, 2025, forensic review of the incident had ended, with a public notification later released this month.During the breach, McLaren noted IT and phone systems were down, resulting in some surgeries, appointments and treatments being canceled or rescheduled."McLaren determined that personal information and protected health information pertaining to individuals was contained within the files involved," the notice reads.During the incident, staff resorted to manually managing appointments and medication information.Despite first failing to mention how systems were breached, McLaren later confirmed it was due to a ransomware attack."Our organization was the target of a cybersecurity attack by an international ransomware group that impacted the McLaren Health Care and Karmanos Cancer Institute computer network," the notice continues.It's not the first time McLaren has been the victim of a ransomware attack – earlier in July 2023, the AlphV/BlackCat gang carried out an attack affecting 2.2 million individuals."There is currently no evidence that your information has been misused," McLaren stated, however affected individuals are being offered a year of free credit monitoring.Potential victims affected by the breach should also remain vigilant and pay attention to any suspicious activity on their accounts.You might also likeCheck out the best identity theft protection servicesDownloaded something dodgy? Here's the best malware removalThis new ransomware could be deadly for your most precious files - here's how to stay protected